DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4927 and CG30025

DIOPT Version :9

Sequence 1:NP_001033953.1 Gene:CG4927 / 36852 FlyBaseID:FBgn0034139 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_725036.1 Gene:CG30025 / 246398 FlyBaseID:FBgn0050025 Length:253 Species:Drosophila melanogaster


Alignment Length:258 Identity:67/258 - (25%)
Similarity:107/258 - (41%) Gaps:42/258 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 IVGGAKAAGREFPFMALLGQRGKNSSQIDWDCGAIIIHPKFVLTAAHCLETSETKEQRLDPNYDG 169
            ||||:......||:...|.:.|.:|      ||..|.....::||||||::......:       
  Fly    31 IVGGSATTISSFPWQISLQRSGSHS------CGGSIYSSNVIVTAAHCLQSVSASVLQ------- 82

  Fly   170 PKYVVRLGELDYNS--TTDDAQPQDFRVLNYVVHPAYGEDDDTGSRKNDIAVVELEMEATFSEYV 232
                :|.|...::|  .|       |.|.::..|..|    :..:..||||::::....|||..:
  Fly    83 ----IRAGSSYWSSGGVT-------FSVSSFKNHEGY----NANTMVNDIAIIKINGALTFSSTI 132

  Fly   233 APACLPLDGGNEQLQVAAAGWGATS-ESGHASSHLLKVSLDRYDVAEC-SQRLEHKIDVR-TQLC 294
            ....|...........:.:|||..| .|....|.|..|:::....::| |....:...:| |.:|
  Fly   133 KAIGLASSNPANGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTMIC 197

  Fly   295 AGSRSTSADTCYGDSGGPVFVQHPIYSCLKQVIGITSYGLVCGVQGLPSVYTKVHLYTDWIEN 357
            |.  ::..|.|.||||||: |...:      ::|:.|:|..|.....|.||..|.....|:.|
  Fly   198 AA--ASGKDACQGDSGGPL-VSGGV------LVGVVSWGYGCAYSNYPGVYADVAALRSWVIN 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4927NP_001033953.1 Tryp_SPc 105..358 CDD:238113 67/258 (26%)
Tryp_SPc 105..355 CDD:214473 65/254 (26%)
CG30025NP_725036.1 Tryp_SPc 30..249 CDD:214473 65/254 (26%)
Tryp_SPc 31..252 CDD:238113 67/258 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.