DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4927 and CG30002

DIOPT Version :9

Sequence 1:NP_001033953.1 Gene:CG4927 / 36852 FlyBaseID:FBgn0034139 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_001163100.1 Gene:CG30002 / 246384 FlyBaseID:FBgn0260474 Length:311 Species:Drosophila melanogaster


Alignment Length:308 Identity:90/308 - (29%)
Similarity:135/308 - (43%) Gaps:87/308 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 EKECR-RFNEIRTSCRTTPFIVGGAKAAGREFPFMALLGQRGKNSSQIDW-DCGAIIIHPKFVLT 148
            :::|. |.|:| .:.|....|.||.|::....|:||.|    ..:|.::. .||..:|...||||
  Fly    43 QQDCGVRSNQI-PAVRIRFMITGGRKSSLMSQPWMAFL----HIASDLEMCRCGGSLISELFVLT 102

  Fly   149 AAHCLE-TSETKEQRLDPNYDGPKYVVRLGELDYNSTTD---------DAQP-QDFRVLNYVVH- 201
            ||||.: ...:||.|           |.|||||.:||:|         .|.| ::|.:..:::| 
  Fly   103 AAHCFKMCPRSKEIR-----------VWLGELDLSSTSDCTTYNYERVCAPPVEEFTIDKWILHE 156

  Fly   202 ------PAYGEDDDTGSRKNDIAVVELEMEATFSEYVAPACLPLDGGNEQL--------QVAAAG 252
                  |.|           |||:::|..:..|.:::.|.||||.  :|.|        :..|.|
  Fly   157 EFNLFYPGY-----------DIALIKLNKKVVFKDHIRPICLPLT--DELLAFTLQLGQRFMAVG 208

  Fly   253 WGATSESGHASSHLLKVSLDRYDVAECSQRLEHKIDVRTQLCAGSRSTS--------ADTCYGDS 309
            ||.|....:|:|.:                   ::|:||:.|...|.||        .|||.|||
  Fly   209 WGKTESLRYANSTM-------------------EVDIRTEKCTDGRDTSFLCASGDYVDTCNGDS 254

  Fly   310 GGPVFVQHPIYSCLKQV-IGITSYGLV-CGVQGLPSVYTKVHLYTDWI 355
            |||:..:..::...:.| .|:.|.|.. ||. |..:.|..|..|..||
  Fly   255 GGPLLWKTTLFGKDRAVQFGVVSTGSQNCGA-GHKAYYMDVPTYMPWI 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4927NP_001033953.1 Tryp_SPc 105..358 CDD:238113 85/288 (30%)
Tryp_SPc 105..355 CDD:214473 83/286 (29%)
CG30002NP_001163100.1 Tryp_SPc 62..301 CDD:214473 83/286 (29%)
Tryp_SPc 62..301 CDD:238113 83/286 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456049
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.