DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4927 and Plau

DIOPT Version :9

Sequence 1:NP_001033953.1 Gene:CG4927 / 36852 FlyBaseID:FBgn0034139 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_032899.1 Gene:Plau / 18792 MGIID:97611 Length:433 Species:Mus musculus


Alignment Length:405 Identity:110/405 - (27%)
Similarity:164/405 - (40%) Gaps:97/405 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 CSI-LSEFCDNGTGEC-----------KELSATDCPSIF---FNLHLIRNFVKYCDKSNHIVCCL 64
            |.| .|:.|.:|.|:.           :...|.:.|::.   :|.|..........|.|:   |.
Mouse    63 CEIDASKTCYHGNGDSYRGKANTDTKGRPCLAWNAPAVLQKPYNAHRPDAISLGLGKHNY---CR 124

  Fly    65 LPNNMQPQSQQFS-ANIGLRRFEKEC-----------------RRFNEIRTSCRTTPFIVGGAKA 111
            .|:|   |.:.:. ..||||:|.:||                 :.|...:.:.|....||||...
Mouse   125 NPDN---QKRPWCYVQIGLRQFVQECMVHDCSLSKKPSSSVDQQGFQCGQKALRPRFKIVGGEFT 186

  Fly   112 AGREFPFMALLGQRGKNSSQIDWDCGAIIIHPKFVLTAAHCLETSETKEQRLDPNYDGPKYVVRL 176
            .....|:.|.:.|:.|..|...:.||..:|.|.:|.:||||......||          .|||.|
Mouse   187 EVENQPWFAAIYQKNKGGSPPSFKCGGSLISPCWVASAAHCFIQLPKKE----------NYVVYL 241

  Fly   177 G---ELDYNSTTDDAQPQD--FRVLNYVVHPAYGEDDDTGSRKNDIAVVELEME----ATFSEYV 232
            |   |..||       |.:  |.|...::|..|.|  |:.:..||||::::...    |..|..:
Mouse   242 GQSKESSYN-------PGEMKFEVEQLILHEYYRE--DSLAYHNDIALLKIRTSTGQCAQPSRSI 297

  Fly   233 APACLP---LDG--GNEQLQVAAAGWGATSESGHASSHLLKVSLDR-YDVAECSQ------RLEH 285
            ...|||   .|.  |::   ....|:|..|||.:.....||:|:.: ....:|.|      .:.:
Mouse   298 QTICLPPRFTDAPFGSD---CEITGFGKESESDYLYPKNLKMSVVKLVSHEQCMQPHYYGSEINY 359

  Fly   286 KIDVRTQLCAGSRSTSADTCYGDSGGPVFVQ---HPIYSCLKQVIGITSYGLVCGVQGLPSVYTK 347
            |:     |||.......|:|.||||||:...   .|..|      ||.|:|..|..:..|.|||:
Mouse   360 KM-----LCAADPEWKTDSCKGDSGGPLICNIEGRPTLS------GIVSWGRGCAEKNKPGVYTR 413

  Fly   348 VHLYTDWIENIVWGE 362
            |..:.|||::.: ||
Mouse   414 VSHFLDWIQSHI-GE 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4927NP_001033953.1 Tryp_SPc 105..358 CDD:238113 83/276 (30%)
Tryp_SPc 105..355 CDD:214473 81/273 (30%)
PlauNP_032899.1 Binds urokinase plasminogen activator surface receptor. /evidence=ECO:0000250 35..58
Kringle 71..152 CDD:333799 20/86 (23%)
Connecting peptide 153..179 2/25 (8%)
Tryp_SPc 180..424 CDD:238113 83/276 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 119 1.000 Inparanoid score I4773
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.