DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4927 and CLIPA5

DIOPT Version :9

Sequence 1:NP_001033953.1 Gene:CG4927 / 36852 FlyBaseID:FBgn0034139 Length:362 Species:Drosophila melanogaster
Sequence 2:XP_320729.4 Gene:CLIPA5 / 1280861 VectorBaseID:AGAP011787 Length:397 Species:Anopheles gambiae


Alignment Length:359 Identity:96/359 - (26%)
Similarity:145/359 - (40%) Gaps:72/359 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 NGTG--ECKELSATDCPSIFFNLHLIRNFVKYCDKSNHIVCCLLPNNMQPQSQQFSANIGLRRFE 86
            ||.|  :.:..:..:||          ::::.|..:..::....|..::|..             
Mosquito    66 NGRGVIDIRVNAEPECP----------HYLETCCNARSVLDSPPPGVIKPSG------------- 107

  Fly    87 KECRRFNEIRTSC-----RTTPFIVGGAKAAGR---EFPFM--ALLGQRGKNSSQI--DWDCGAI 139
                |..::|.:|     ....|.|.|.|....   |||:|  .:|.....||..|  .:.||..
Mosquito   108 ----RTEQVRPTCGVRNKNGLGFSVTGVKDGESHYGEFPWMVAVMLSSPMDNSDSILNVYQCGGS 168

  Fly   140 IIHPKFVLTAAHCLETSETKEQRLDPNYDGPK--YVVRLGELDYNSTTDDAQPQDFRVLNYVVHP 202
            :|.|..|||||||:             ::.||  .::|.||.|..:..:....|:.||...::|.
Mosquito   169 VIAPNVVLTAAHCV-------------FNKPKTQLLLRAGEWDTQTEHELYMHQNRRVAEVILHE 220

  Fly   203 AYGEDDDTGSRKNDIAVVELEMEATFSEYVAPACLPLDGGNEQLQ-VAAAGWGAT--SESGHASS 264
            |:    |..|..||:|::.|.......|.|.|.|||..|.:...| ..|:|||..  .:.|....
Mosquito   221 AF----DNESLANDVALLTLAEPFQLGENVQPICLPPSGTSFDYQHCFASGWGKDQFGKEGKYQV 281

  Fly   265 HLLKVSLDRYDVAECSQRLEHK-------IDVRTQLCAGSRSTSADTCYGDSGGPVFVQHPIYSC 322
            .|.||.|.....|:|.:.:..:       :| ::.||||. ....|.|.||.|.|:....|....
Mosquito   282 ILKKVELPVVPHAKCQETMRSQRVGNWFVLD-QSFLCAGG-VAGQDMCRGDGGSPLVCPIPGSPT 344

  Fly   323 LKQVIGITSYGLVCGVQGLPSVYTKVHLYTDWIE 356
            .....||.::||.||..|:|.||..|....|||:
Mosquito   345 HYYQAGIVAWGLGCGEDGIPGVYGDVAFLRDWID 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4927NP_001033953.1 Tryp_SPc 105..358 CDD:238113 84/271 (31%)
Tryp_SPc 105..355 CDD:214473 82/268 (31%)
CLIPA5XP_320729.4 Tryp_SPc 135..380 CDD:238113 81/263 (31%)
Tryp_SPc 135..377 CDD:214473 79/260 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.