DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4927 and AgaP_AGAP005591

DIOPT Version :9

Sequence 1:NP_001033953.1 Gene:CG4927 / 36852 FlyBaseID:FBgn0034139 Length:362 Species:Drosophila melanogaster
Sequence 2:XP_315601.4 Gene:AgaP_AGAP005591 / 1276277 VectorBaseID:AGAP005591 Length:273 Species:Anopheles gambiae


Alignment Length:268 Identity:60/268 - (22%)
Similarity:114/268 - (42%) Gaps:52/268 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 TPFIVGGAKAAGREFPFMALLGQRGKNSSQIDWDCGAIIIHPKFVLTAAHCLETSETKEQRLDPN 166
            :|....|..|...:||:.|.|..:.|:|::: :.|...:|.|.::||.|.|:            |
Mosquito    36 SPLATDGYLAYPGQFPYHAALRFKTKSSTKV-YTCAGSLITPVYILTTAACV------------N 87

  Fly   167 YDGPKYVVR-LGELDYNSTTDDAQPQDFRVLNYVVHP---AYGEDDDTGSRKNDIAVVELEMEAT 227
            ::..:|... ||.| :|..|:..|..:..:....:||   .||.        ||||.:.::..||
Mosquito    88 HNSVEYAFAILGSL-FNGNTEWEQHINITMNGIRIHPPSSMYGH--------NDIATIHMDHPAT 143

  Fly   228 FSEYVAPACLPLDGGNEQLQVAAAGWGATSESGHASSHLLKVSLDRYDVAECSQRLEHKIDVRTQ 292
            .:|||.|..||........:: ..|...::.:|....:|....:..   |:|.:.::...::.:|
Mosquito   144 LNEYVQPIRLPRLSDTRTYEM-MEGTATSALNGDGLRYLRNQVMSN---ADCHEAIQPLYNISSQ 204

  Fly   293 -LC-----AGS---RSTSADTCYGDSGGPVFVQHPIYSCLKQVIGITSYGLVCGVQGLPSVYTKV 348
             :|     .||   |:|.:.....|..|            :.::|:.:..::|.:. .|..:.:|
Mosquito   205 HICTDTYIGGSLCGRTTGSALTVEDENG------------RMLVGVGNLIVLCDLH-YPIRHIRV 256

  Fly   349 HLYTDWIE 356
            ..:.:|||
Mosquito   257 SYFREWIE 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4927NP_001033953.1 Tryp_SPc 105..358 CDD:238113 59/265 (22%)
Tryp_SPc 105..355 CDD:214473 56/262 (21%)
AgaP_AGAP005591XP_315601.4 Tryp_SPc 42..264 CDD:238113 57/260 (22%)
Tryp_SPc 42..263 CDD:214473 56/259 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.