DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4927 and AgaP_AGAP007251

DIOPT Version :9

Sequence 1:NP_001033953.1 Gene:CG4927 / 36852 FlyBaseID:FBgn0034139 Length:362 Species:Drosophila melanogaster
Sequence 2:XP_308541.4 Gene:AgaP_AGAP007251 / 1269887 VectorBaseID:AGAP007251 Length:313 Species:Anopheles gambiae


Alignment Length:266 Identity:72/266 - (27%)
Similarity:116/266 - (43%) Gaps:41/266 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 IVGGAKAAGREFPFMA-LLGQRGKNSSQIDWDCGAIIIHPKFVLTAAHCLETSETKEQRLDPNYD 168
            |..|.:|...:||:.| ||.:.|..:..    ||..::.|.|:||||||:        .||....
Mosquito    67 ITNGLEARVGQFPYQALLLTEFGMFTIM----CGGTVLTPNFILTAAHCV--------MLDQTTK 119

  Fly   169 GPKYVVRLGELDYNSTTDDAQPQDFRVLNYVVHPAYGEDDDTGSR-KNDIAVVELEMEATFSEYV 232
            ....:..||..:........|...|.....:|||:|     |.:. :.|:|:|.|.....|:.||
Mosquito   120 ATGGMAILGAHNRMVVESTQQRIRFATSGIIVHPSY-----TATNFRFDVAMVRLNAPLRFNSYV 179

  Fly   233 APACLP-------LDGGNEQLQVAAAGWGATSESGHASSHLLKVSLDR-YDVAECSQRLEHKIDV 289
            .|..||       .||    :....:|:|.|::.......:|:.:::. .....|:.|....:..
Mosquito   180 QPVRLPARTDQRLFDG----IIGTVSGFGRTNDKDGILPSILRYTINTILSNGACAARWGSLLVE 240

  Fly   290 RTQLCA---GSRSTSADTCYGDSGGPVFVQHPIYSCLKQVIGITSYGLVCG-VQGLPSVYTKVHL 350
            ...:|.   |.||    .|.||||||:.::.  :..:...:|:||:|...| ..|:|:||.:|..
Mosquito   241 PHNICLSGDGGRS----ACVGDSGGPLTIEE--WGGITYQVGVTSFGSGNGCTDGMPTVYGRVSY 299

  Fly   351 YTDWIE 356
            :.|||:
Mosquito   300 FLDWIK 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4927NP_001033953.1 Tryp_SPc 105..358 CDD:238113 72/266 (27%)
Tryp_SPc 105..355 CDD:214473 70/263 (27%)
AgaP_AGAP007251XP_308541.4 Tryp_SPc 66..304 CDD:214473 70/263 (27%)
Tryp_SPc 67..307 CDD:238113 72/266 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25778
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.