DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4927 and LOC101886682

DIOPT Version :9

Sequence 1:NP_001033953.1 Gene:CG4927 / 36852 FlyBaseID:FBgn0034139 Length:362 Species:Drosophila melanogaster
Sequence 2:XP_005170582.2 Gene:LOC101886682 / 101886682 -ID:- Length:252 Species:Danio rerio


Alignment Length:311 Identity:82/311 - (26%)
Similarity:124/311 - (39%) Gaps:80/311 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 IVCCLLPNNMQPQSQQFSANIGLRRFEKECRRFNEIRTSCRTTPFIVGGAKAAGREFPFMALLGQ 124
            |:..||..::.| ...|:|.:|                       |..|.:|.....|:|..|  
Zfish     6 IISLLLLVSLVP-DLTFTARVG-----------------------IEDGTEAKPHSRPYMVSL-- 44

  Fly   125 RGKNSSQIDWDCGAIIIHPKFVLTAAHCLETSETKEQRLDPNYDGPKYVVRLGELD------YNS 183
             ..||..|   ||..:|..:||||||||.:..:.             ..|..|..|      ||:
Zfish    45 -QINSQHI---CGGSLISKEFVLTAAHCWDKDDV-------------LTVVTGAHDLRKKAIYNT 92

  Fly   184 TTDDAQPQDFRVLNYVVHPAYGEDDDTGSRKNDIAVVELEMEATFSEYVAPACLPLDGGNEQLQV 248
                     |:|.:|:.||.|    ::.:.:|||.:::|:.:...|..|....||.:|  |.|:.
Zfish    93 ---------FKVTSYIPHPDY----NSYTLENDIMLLKLKTKVRLSNSVGLISLPRNG--EDLKA 142

  Fly   249 ----AAAGWGATSESGHASSHLLKVSLDRYDVAECSQRLEHKIDVRTQLCAGSRSTSADTCYGDS 309
                :.||||.....|..:..|.:......:.|||.:|.|........:||...   ..||.|||
Zfish   143 DTLCSIAGWGRLWRKGAKTDRLREAETVIVNDAECERRWESDYVASKMICAYGH---GGTCSGDS 204

  Fly   310 GGPVFVQHPIYSCLKQVIGITSYG--LVCGVQGLPSVYTKVHLYTDWIENI 358
            |||:.       |....:|||::.  .:|..:..|.|:.::..|..||:||
Zfish   205 GGPLV-------CNNTAVGITAFSDRYLCKSRLFPDVFARISAYLPWIQNI 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4927NP_001033953.1 Tryp_SPc 105..358 CDD:238113 73/264 (28%)
Tryp_SPc 105..355 CDD:214473 71/261 (27%)
LOC101886682XP_005170582.2 Tryp_SPc 27..248 CDD:238113 73/264 (28%)
Tryp_SPc 27..245 CDD:214473 71/261 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D476534at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.