DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4927 and tmprss2.15

DIOPT Version :9

Sequence 1:NP_001033953.1 Gene:CG4927 / 36852 FlyBaseID:FBgn0034139 Length:362 Species:Drosophila melanogaster
Sequence 2:XP_031752206.1 Gene:tmprss2.15 / 101732233 XenbaseID:XB-GENE-22065943 Length:504 Species:Xenopus tropicalis


Alignment Length:392 Identity:101/392 - (25%)
Similarity:158/392 - (40%) Gaps:82/392 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 ICSILSEFCD------NGTGE--CKEL-------------SATDCPSIFFNLHLIRNFVKYCDKS 57
            :|.:.|::||      |||.|  |..|             .||..|..         :.::.|.|
 Frog   136 VCVLYSQWCDGIPQCPNGTDEQTCVRLYGPNFQLQAYSPAKATWLPVC---------YDEWSDNS 191

  Fly    58 NHIVCCLLPNNMQP--QSQQF------------SANIGLR-----RFEKECRRFNEIRTSC---- 99
            ..|.|..:..:|..  ||.|.            |:|:..:     .:...|...|.:...|    
 Frog   192 GKIACQDIGYSMSSYYQSSQLLASSSNGYFVLQSSNVTGKMYTNLNYSATCASGNMVSLRCISCG 256

  Fly   100 ---RTTPFIVGGAKAAGREFPFMALLGQRGKNSSQIDWDCGAIIIHPKFVLTAAHCLETSETKEQ 161
               :....||||..|:..::|:...|.:....|..:   ||..||.|.:::|||||:..|.:...
 Frog   257 LSTKVDSRIVGGTPASVGDWPWQVELLKLVGTSIYL---CGGSIITPHWIVTAAHCVYGSTSTPS 318

  Fly   162 RLDPNYDGPKYVVRLGELDYNSTTDDAQPQDFRVLNYVVHPAYGEDDDTGSRKNDIAVVELEMEA 226
                     .:.|..|.|    |........:.|...:|||:|    .:.::..|:|:::|....
 Frog   319 ---------AFKVFAGSL----TIQSYYSAGYTVERALVHPSY----SSYTQIYDVALLKLTAAL 366

  Fly   227 TFSEYVAPACLPLDG--GNEQLQVAAAGWGATSESGHASSHLLKVSLDRYDVAECSQRLEHKIDV 289
            .|:..:.|.|||..|  ..|......:|||.|:|.|..|.:|:..|:.......|:|...:...:
 Frog   367 VFTTNLRPVCLPNVGMPWAEGQPCWISGWGTTAEGGSISKNLMAASVPIISSTTCNQAAVYGGAI 431

  Fly   290 -RTQLCAGSRSTSADTCYGDSGGPVFVQHPIYSCLKQVIGITSYGLVCGVQGLPSVYTKVHLYTD 353
             .|.:|||..|...|||.||||||:..:   .:.|..::|.||:|..|.....|.||..|.::.:
 Frog   432 SSTMMCAGYLSGGTDTCQGDSGGPLVTK---TNSLWWLVGDTSWGYGCARAYKPGVYGNVTVFIE 493

  Fly   354 WI 355
            ||
 Frog   494 WI 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4927NP_001033953.1 Tryp_SPc 105..358 CDD:238113 75/254 (30%)
Tryp_SPc 105..355 CDD:214473 73/252 (29%)
tmprss2.15XP_031752206.1 LDLa 93..121 CDD:238060
SRCR_2 164..259 CDD:406055 16/103 (16%)
Tryp_SPc 265..498 CDD:238113 75/254 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.