DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4927 and XB5962685

DIOPT Version :9

Sequence 1:NP_001033953.1 Gene:CG4927 / 36852 FlyBaseID:FBgn0034139 Length:362 Species:Drosophila melanogaster
Sequence 2:XP_002941155.3 Gene:XB5962685 / 100496550 XenbaseID:XB-GENE-5962686 Length:251 Species:Xenopus tropicalis


Alignment Length:264 Identity:76/264 - (28%)
Similarity:118/264 - (44%) Gaps:53/264 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 IVGGAKAAGREFPFMALLGQRGKNSSQIDWDCGAIIIHPKFVLTAAHCLETSETKEQRLDPNYDG 169
            |.||.:|......:|||: :.|.|.      ||..:|...:|||||.|.....|           
 Frog    23 ITGGKEAIPHARRYMALV-RTGSNL------CGGTLIKDNWVLTAATCKVDRTT----------- 69

  Fly   170 PKYVVRLGELDYNSTTDDAQPQDFRVLNYVVHPAYGEDDDTGSRKNDIAVVELEMEATFSEYVAP 234
               .|.||.  ::..|.:...|.|:|..:|.|..:    |..|..|::.:::|..:|.||..|..
 Frog    70 ---TVDLGV--HSIKTMNKLRQQFKVARWVPHQKF----DRRSYVNNLQLLQLSSKANFSYAVNI 125

  Fly   235 ACLP-----LDGGNEQLQVAAAGWGATSESG-HASSHLLKVSLDRYDVAECSQRLEHKIDV-RTQ 292
            ..||     :..|.   ....||||.|:.:| ..|..|::|||...|..:|:.:.:.||.: :..
 Frog   126 LLLPTKYKDIKPGT---VCETAGWGITAYNGKQQSDKLMEVSLTVLDRMQCNNQWKSKIKITKDM 187

  Fly   293 LCA---GSRSTSADTCYGDSGGPVFVQHPIYSCLKQVIGITSYG-LVCGVQGLPSVYTKV-HLYT 352
            :|.   |.|.    .|.||.|||:.       |.:.:.|:.|:| |:||::...:|||:: ..|.
 Frog   188 MCTRDKGKRG----FCNGDGGGPLI-------CNRILTGVISFGPLICGMENGANVYTRLTSNYI 241

  Fly   353 DWIE 356
            .||:
 Frog   242 KWIK 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4927NP_001033953.1 Tryp_SPc 105..358 CDD:238113 76/264 (29%)
Tryp_SPc 105..355 CDD:214473 74/261 (28%)
XB5962685XP_002941155.3 Tryp_SPc 23..246 CDD:238113 76/264 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D476534at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.