DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4927 and si:dkey-78l4.13

DIOPT Version :9

Sequence 1:NP_001033953.1 Gene:CG4927 / 36852 FlyBaseID:FBgn0034139 Length:362 Species:Drosophila melanogaster
Sequence 2:XP_003201101.3 Gene:si:dkey-78l4.13 / 100034660 ZFINID:ZDB-GENE-060503-459 Length:253 Species:Danio rerio


Alignment Length:263 Identity:68/263 - (25%)
Similarity:114/263 - (43%) Gaps:46/263 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 IVGGAKAAGREFPFMALLGQRGKNSSQIDWDCGAIIIHPKFVLTAAHCLETSETKEQRLDPNYDG 169
            ||.|.:|.....|:|..:....|:.      ||..::..:||:|||||.             .:|
Zfish    25 IVNGNEARPHSRPYMVSVQCNRKHI------CGGFLVSEQFVMTAAHCF-------------VNG 70

  Fly   170 PKYVVRLGELDYNSTTDDAQPQDFRVLNYVVHPAYGEDDDTGSRKNDIAVVELEMEATFSEYVAP 234
            .:..|.:|..:|   ||.|...|.:.  |.:||.:    ::.:..|||.:::|..:...|..|  
Zfish    71 KELTVVVGAHEY---TDGASRMDVKF--YHIHPGF----ESKTLLNDIMLLQLHKKVKKSNKV-- 124

  Fly   235 ACLPLDGGNEQLQV----AAAGWGATSESGHASSHLLKVSLDRYDVAECSQRLEHKIDVRTQLCA 295
            ..:|:...::.::.    :.||||..:..|..|:.|::|::..:|...|.:...........:|.
Zfish   125 NWIPIPNADKDIKAKTKCSVAGWGKNTTHGEVSAKLMEVNVTLFDKKACQKYWGPTYSTSKMMCT 189

  Fly   296 GSRSTSADTCYGDSGGPVFVQHPIYSCLKQVIGITSYGLV--CGVQGLPSVYTKVHLYTDWIENI 358
            |..   ...|.||||||:.       |.|..:||.|:...  |.....|:|||::..:..||:.|
Zfish   190 GGH---GGFCQGDSGGPLV-------CDKVAVGIVSFNEKNNCDSPTKPNVYTQISKFLSWIKCI 244

  Fly   359 VWG 361
            |.|
Zfish   245 VGG 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4927NP_001033953.1 Tryp_SPc 105..358 CDD:238113 65/258 (25%)
Tryp_SPc 105..355 CDD:214473 63/255 (25%)
si:dkey-78l4.13XP_003201101.3 Tryp_SPc 25..242 CDD:238113 64/256 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1144875at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.