DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS15 and RSM19

DIOPT Version :10

Sequence 1:NP_611136.1 Gene:RpS15 / 36851 FlyBaseID:FBgn0034138 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_014435.3 Gene:RSM19 / 855773 SGDID:S000005320 Length:91 Species:Saccharomyces cerevisiae


Alignment Length:84 Identity:27/84 - (32%)
Similarity:46/84 - (54%) Gaps:6/84 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 ARRRFSRGLKRKPMALIKKLRKAKKEAPPNEKPEIVKTHLRNMIIVPEMTGSIIGVYNGKDFGQV 108
            |.|..||.:.:.|..:...:|:|..:..|      ::|:.|...|:|:..|....::|||::..:
Yeast     4 AARLLSRSVWKGPNIVPLPIREAMTKGTP------IRTNARAATILPQFVGLKFQIHNGKEYVPI 62

  Fly   109 EVKPEMIGHYLGEFALTYK 127
            |:..:|:||.|||||.|.|
Yeast    63 EISEDMVGHKLGEFAPTRK 81

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS15NP_611136.1 PTZ00096 20..146 CDD:185442 27/84 (32%)
RSM19NP_014435.3 Ribosomal_S19 11..85 CDD:459710 23/77 (30%)

Return to query results.
Submit another query.