DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS15 and AT1G33850

DIOPT Version :9

Sequence 1:NP_611136.1 Gene:RpS15 / 36851 FlyBaseID:FBgn0034138 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_174647.1 Gene:AT1G33850 / 840281 AraportID:AT1G33850 Length:70 Species:Arabidopsis thaliana


Alignment Length:64 Identity:43/64 - (67%)
Similarity:47/64 - (73%) Gaps:0/64 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VDENLKKKRTFKKFTYRGVDLDQLLDMPNNQLVELMHSRARRRFSRGLKRKPMALIKKLRKAKK 68
            |...:.|||.||||::||||||.||||....||:...||.|||||||..|||||||||||||.|
plant     6 VAAGIVKKRIFKKFSFRGVDLDALLDMSTEDLVKHFSSRIRRRFSRGFTRKPMALIKKLRKAVK 69

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS15NP_611136.1 PTZ00096 20..146 CDD:185442 35/49 (71%)
AT1G33850NP_174647.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0185
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1390881at2759
OrthoFinder 1 1.000 - - FOG0002162
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.