powered by:
Protein Alignment RpS15 and AT1G33850
DIOPT Version :9
Sequence 1: | NP_611136.1 |
Gene: | RpS15 / 36851 |
FlyBaseID: | FBgn0034138 |
Length: | 148 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_174647.1 |
Gene: | AT1G33850 / 840281 |
AraportID: | AT1G33850 |
Length: | 70 |
Species: | Arabidopsis thaliana |
Alignment Length: | 64 |
Identity: | 43/64 - (67%) |
Similarity: | 47/64 - (73%) |
Gaps: | 0/64 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 5 VDENLKKKRTFKKFTYRGVDLDQLLDMPNNQLVELMHSRARRRFSRGLKRKPMALIKKLRKAKK 68
|...:.|||.||||::||||||.||||....||:...||.|||||||..|||||||||||||.|
plant 6 VAAGIVKKRIFKKFSFRGVDLDALLDMSTEDLVKHFSSRIRRRFSRGFTRKPMALIKKLRKAVK 69
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
RpS15 | NP_611136.1 |
PTZ00096 |
20..146 |
CDD:185442 |
35/49 (71%) |
AT1G33850 | NP_174647.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0185 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1390881at2759 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0002162 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
4 | 3.820 |
|
Return to query results.
Submit another query.