DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS15 and RPS15

DIOPT Version :9

Sequence 1:NP_611136.1 Gene:RpS15 / 36851 FlyBaseID:FBgn0034138 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_171923.1 Gene:RPS15 / 839564 AraportID:AT1G04270 Length:152 Species:Arabidopsis thaliana


Alignment Length:152 Identity:115/152 - (75%)
Similarity:127/152 - (83%) Gaps:4/152 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MADQVDE----NLKKKRTFKKFTYRGVDLDQLLDMPNNQLVELMHSRARRRFSRGLKRKPMALIK 61
            |||...|    .:.||||||||.::|||||.||||..:.||:|..||.||||||||.||||||||
plant     1 MADVEPEVAAAGVPKKRTFKKFAFKGVDLDALLDMSTDDLVKLFSSRIRRRFSRGLTRKPMALIK 65

  Fly    62 KLRKAKKEAPPNEKPEIVKTHLRNMIIVPEMTGSIIGVYNGKDFGQVEVKPEMIGHYLGEFALTY 126
            ||||||:|||..||||.|:||||||||||||.||||||||||.|.|||:|||||||||.||:::|
plant    66 KLRKAKREAPQGEKPEPVRTHLRNMIIVPEMIGSIIGVYNGKTFNQVEIKPEMIGHYLAEFSISY 130

  Fly   127 KPVKHGRPGIGATHSSRFIPLK 148
            |||||||||:||||||||||||
plant   131 KPVKHGRPGVGATHSSRFIPLK 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS15NP_611136.1 PTZ00096 20..146 CDD:185442 99/125 (79%)
RPS15NP_171923.1 PTZ00096 10..150 CDD:185442 107/139 (77%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 151 1.000 Domainoid score I1387
eggNOG 1 0.900 - - E1_COG0185
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 230 1.000 Inparanoid score I1142
OMA 1 1.010 - - QHG62186
OrthoDB 1 1.010 - - D1390881at2759
OrthoFinder 1 1.000 - - FOG0002162
OrthoInspector 1 1.000 - - otm2721
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11880
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1624
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.940

Return to query results.
Submit another query.