DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS15 and AT5G63070

DIOPT Version :9

Sequence 1:NP_611136.1 Gene:RpS15 / 36851 FlyBaseID:FBgn0034138 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_201112.1 Gene:AT5G63070 / 836427 AraportID:AT5G63070 Length:160 Species:Arabidopsis thaliana


Alignment Length:144 Identity:87/144 - (60%)
Similarity:109/144 - (75%) Gaps:6/144 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 KKRTFKKFTYRGVDLDQLLDMPNNQLVELMHSRARRRFSRGLKRKPMALIKKLRKAKKEAPPNE- 74
            ||||||||::||.::|.||.|.|..|.:|.::|.||||.||||::|:.||||||:|||||.... 
plant    17 KKRTFKKFSFRGFNVDALLKMSNVDLAKLFNARVRRRFYRGLKKQPLILIKKLRRAKKEASDENK 81

  Fly    75 -KPEIVKTHLRNMIIVPEMTGSIIGVYNGKDFGQVEVKPEMIGHYLGEFALTYKPVKHGRPGIGA 138
             |||:||||||||||||||.||::||:|||.|.::.:|||||||||.||::|.|.|.|.||.|..
plant    82 MKPEVVKTHLRNMIIVPEMIGSVVGVHNGKKFNEIVIKPEMIGHYLAEFSMTCKKVNHHRPRICG 146

  Fly   139 ----THSSRFIPLK 148
                ..|:|||||:
plant   147 CCCFRRSTRFIPLR 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS15NP_611136.1 PTZ00096 20..146 CDD:185442 76/131 (58%)
AT5G63070NP_201112.1 Ribosomal_S19 13..158 CDD:412326 84/140 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0185
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62186
OrthoDB 1 1.010 - - D1390881at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11880
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.890

Return to query results.
Submit another query.