DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS15 and AT5G09500

DIOPT Version :9

Sequence 1:NP_611136.1 Gene:RpS15 / 36851 FlyBaseID:FBgn0034138 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_196512.1 Gene:AT5G09500 / 830809 AraportID:AT5G09500 Length:150 Species:Arabidopsis thaliana


Alignment Length:150 Identity:112/150 - (74%)
Similarity:125/150 - (83%) Gaps:2/150 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MADQ--VDENLKKKRTFKKFTYRGVDLDQLLDMPNNQLVELMHSRARRRFSRGLKRKPMALIKKL 63
            |||.  ....:.||||||||::||||||.||||..:.||:|..||.||||||||.||||||||||
plant     1 MADPEVAAAGIVKKRTFKKFSFRGVDLDALLDMSTDDLVKLFPSRIRRRFSRGLTRKPMALIKKL 65

  Fly    64 RKAKKEAPPNEKPEIVKTHLRNMIIVPEMTGSIIGVYNGKDFGQVEVKPEMIGHYLGEFALTYKP 128
            ||||.|||..|||..|:||||||||||||.||:|||||||.|.|||:|||||||||.||:::|||
plant    66 RKAKIEAPAGEKPAAVRTHLRNMIIVPEMIGSVIGVYNGKTFNQVEIKPEMIGHYLAEFSISYKP 130

  Fly   129 VKHGRPGIGATHSSRFIPLK 148
            |||||||:|||:||||||||
plant   131 VKHGRPGVGATNSSRFIPLK 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS15NP_611136.1 PTZ00096 20..146 CDD:185442 97/125 (78%)
AT5G09500NP_196512.1 PTZ00096 13..148 CDD:185442 105/134 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 151 1.000 Domainoid score I1387
eggNOG 1 0.900 - - E1_COG0185
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 230 1.000 Inparanoid score I1142
OMA 1 1.010 - - QHG62186
OrthoDB 1 1.010 - - D1390881at2759
OrthoFinder 1 1.000 - - FOG0002162
OrthoInspector 1 1.000 - - otm2721
orthoMCL 1 0.900 - - OOG6_100373
Panther 1 1.100 - - O PTHR11880
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1624
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.840

Return to query results.
Submit another query.