DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS15 and RPS15

DIOPT Version :9

Sequence 1:NP_611136.1 Gene:RpS15 / 36851 FlyBaseID:FBgn0034138 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_001295155.1 Gene:RPS15 / 6209 HGNCID:10388 Length:152 Species:Homo sapiens


Alignment Length:147 Identity:111/147 - (75%)
Similarity:129/147 - (87%) Gaps:0/147 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ADQVDENLKKKRTFKKFTYRGVDLDQLLDMPNNQLVELMHSRARRRFSRGLKRKPMALIKKLRKA 66
            ||..:...||||||:|||||||||||||||...||::|..:|.|||.:|||:||..:|:|:||||
Human     6 ADLAEVEQKKKRTFRKFTYRGVDLDQLLDMSYEQLMQLYSARQRRRLNRGLRRKQHSLLKRLRKA 70

  Fly    67 KKEAPPNEKPEIVKTHLRNMIIVPEMTGSIIGVYNGKDFGQVEVKPEMIGHYLGEFALTYKPVKH 131
            ||||||.||||:||||||:|||:|||.||::||||||.|.|||:||||||||||||::|||||||
Human    71 KKEAPPMEKPEVVKTHLRDMIILPEMVGSMVGVYNGKTFNQVEIKPEMIGHYLGEFSITYKPVKH 135

  Fly   132 GRPGIGATHSSRFIPLK 148
            |||||||||||||||||
Human   136 GRPGIGATHSSRFIPLK 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS15NP_611136.1 PTZ00096 20..146 CDD:185442 96/125 (77%)
RPS15NP_001295155.1 PTZ00096 12..150 CDD:185442 105/137 (77%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159969
Domainoid 1 1.000 146 1.000 Domainoid score I4562
eggNOG 1 0.900 - - E1_COG0185
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 232 1.000 Inparanoid score I3437
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62186
OrthoDB 1 1.010 - - D1390881at2759
OrthoFinder 1 1.000 - - FOG0002162
OrthoInspector 1 1.000 - - oto89235
orthoMCL 1 0.900 - - OOG6_100373
Panther 1 1.100 - - LDO PTHR11880
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2774
SonicParanoid 1 1.000 - - X1624
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1413.840

Return to query results.
Submit another query.