DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS15 and rps15

DIOPT Version :9

Sequence 1:NP_611136.1 Gene:RpS15 / 36851 FlyBaseID:FBgn0034138 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_001011187.1 Gene:rps15 / 496609 XenbaseID:XB-GENE-5832673 Length:145 Species:Xenopus tropicalis


Alignment Length:139 Identity:108/139 - (77%)
Similarity:126/139 - (90%) Gaps:0/139 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KKKRTFKKFTYRGVDLDQLLDMPNNQLVELMHSRARRRFSRGLKRKPMALIKKLRKAKKEAPPNE 74
            ||||||||||||||||||||||...|:::|..:|.|||.:|||:||..:|:|:||||||||||.|
 Frog     7 KKKRTFKKFTYRGVDLDQLLDMSYEQIMQLYCARQRRRLNRGLRRKQNSLLKRLRKAKKEAPPME 71

  Fly    75 KPEIVKTHLRNMIIVPEMTGSIIGVYNGKDFGQVEVKPEMIGHYLGEFALTYKPVKHGRPGIGAT 139
            |||::|||||:|||:|||.||::||||||.|.|||:||||||||||||::|||||||||||||||
 Frog    72 KPEVIKTHLRDMIILPEMVGSMVGVYNGKSFNQVEIKPEMIGHYLGEFSITYKPVKHGRPGIGAT 136

  Fly   140 HSSRFIPLK 148
            |||||||||
 Frog   137 HSSRFIPLK 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS15NP_611136.1 PTZ00096 20..146 CDD:185442 94/125 (75%)
rps15NP_001011187.1 PTZ00096 17..143 CDD:185442 94/125 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H133737
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1390881at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2774
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.