DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS15 and rps15

DIOPT Version :9

Sequence 1:NP_611136.1 Gene:RpS15 / 36851 FlyBaseID:FBgn0034138 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_001001819.1 Gene:rps15 / 337148 ZFINID:ZDB-GENE-030131-9092 Length:145 Species:Danio rerio


Alignment Length:143 Identity:109/143 - (76%)
Similarity:127/143 - (88%) Gaps:0/143 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DENLKKKRTFKKFTYRGVDLDQLLDMPNNQLVELMHSRARRRFSRGLKRKPMALIKKLRKAKKEA 70
            |...||||||:|||||||||||||||...||::|..:|.|||.:|||:||..:|:|:||||||||
Zfish     3 DTEQKKKRTFRKFTYRGVDLDQLLDMSYEQLMQLYSARQRRRLNRGLRRKQQSLLKRLRKAKKEA 67

  Fly    71 PPNEKPEIVKTHLRNMIIVPEMTGSIIGVYNGKDFGQVEVKPEMIGHYLGEFALTYKPVKHGRPG 135
            ||.||||:||||||:|:|:|||.||::||||||.|.|||:||||||||||||::|||||||||||
Zfish    68 PPMEKPEVVKTHLRDMVILPEMVGSMVGVYNGKTFNQVEIKPEMIGHYLGEFSITYKPVKHGRPG 132

  Fly   136 IGATHSSRFIPLK 148
            |||||||||||||
Zfish   133 IGATHSSRFIPLK 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS15NP_611136.1 PTZ00096 20..146 CDD:185442 95/125 (76%)
rps15NP_001001819.1 PTZ00096 1..143 CDD:185442 105/139 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596259
Domainoid 1 1.000 147 1.000 Domainoid score I4474
eggNOG 1 0.900 - - E1_COG0185
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H133737
Inparanoid 1 1.050 233 1.000 Inparanoid score I3400
OMA 1 1.010 - - QHG62186
OrthoDB 1 1.010 - - D1390881at2759
OrthoFinder 1 1.000 - - FOG0002162
OrthoInspector 1 1.000 - - oto41113
orthoMCL 1 0.900 - - OOG6_100373
Panther 1 1.100 - - LDO PTHR11880
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2774
SonicParanoid 1 1.000 - - X1624
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.