DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS15 and rps1502

DIOPT Version :9

Sequence 1:NP_611136.1 Gene:RpS15 / 36851 FlyBaseID:FBgn0034138 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_594357.1 Gene:rps1502 / 2542912 PomBaseID:SPAC1071.07c Length:154 Species:Schizosaccharomyces pombe


Alignment Length:140 Identity:101/140 - (72%)
Similarity:117/140 - (83%) Gaps:0/140 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LKKKRTFKKFTYRGVDLDQLLDMPNNQLVELMHSRARRRFSRGLKRKPMALIKKLRKAKKEAPPN 73
            |:|||||:.|.||||:|:||||:...|||:|.|:|||||..|||.......|:||||||.|||.|
pombe    15 LRKKRTFRTFAYRGVELEQLLDLSAEQLVDLFHARARRRMLRGLGPNASRFIRKLRKAKSEAPLN 79

  Fly    74 EKPEIVKTHLRNMIIVPEMTGSIIGVYNGKDFGQVEVKPEMIGHYLGEFALTYKPVKHGRPGIGA 138
            |||..||||||||||:|||.||::|:||||.|.|||::|||||||||||::||||.|||||||||
pombe    80 EKPATVKTHLRNMIILPEMVGSVVGIYNGKLFNQVEIRPEMIGHYLGEFSITYKPTKHGRPGIGA 144

  Fly   139 THSSRFIPLK 148
            ||||||||||
pombe   145 THSSRFIPLK 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS15NP_611136.1 PTZ00096 20..146 CDD:185442 90/125 (72%)
rps1502NP_594357.1 PTZ00096 13..152 CDD:185442 97/136 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 124 1.000 Domainoid score I1408
eggNOG 1 0.900 - - E1_COG0185
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 214 1.000 Inparanoid score I935
OMA 1 1.010 - - QHG62186
OrthoFinder 1 1.000 - - FOG0002162
OrthoInspector 1 1.000 - - otm47145
orthoMCL 1 0.900 - - OOG6_100373
Panther 1 1.100 - - LDO PTHR11880
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2774
SonicParanoid 1 1.000 - - X1624
TreeFam 1 0.960 - -
1312.860

Return to query results.
Submit another query.