powered by:
Protein Alignment RpS15 and rsm19
DIOPT Version :9
Sequence 1: | NP_611136.1 |
Gene: | RpS15 / 36851 |
FlyBaseID: | FBgn0034138 |
Length: | 148 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_592912.2 |
Gene: | rsm19 / 2542342 |
PomBaseID: | SPAC1751.02c |
Length: | 93 |
Species: | Schizosaccharomyces pombe |
Alignment Length: | 49 |
Identity: | 23/49 - (46%) |
Similarity: | 33/49 - (67%) |
Gaps: | 0/49 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 79 VKTHLRNMIIVPEMTGSIIGVYNGKDFGQVEVKPEMIGHYLGEFALTYK 127
:||.:|:..|:|.|.|:...|:|||.:..|::..:||||.|||||.|.|
pombe 35 IKTAVRSATILPRMVGAQFMVHNGKSYANVKITEDMIGHKLGEFAPTRK 83
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0185 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_100373 |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
1 |
0.960 |
- |
- |
|
|
|
4 | 3.670 |
|
Return to query results.
Submit another query.