DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS15 and rsm19

DIOPT Version :9

Sequence 1:NP_611136.1 Gene:RpS15 / 36851 FlyBaseID:FBgn0034138 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_592912.2 Gene:rsm19 / 2542342 PomBaseID:SPAC1751.02c Length:93 Species:Schizosaccharomyces pombe


Alignment Length:49 Identity:23/49 - (46%)
Similarity:33/49 - (67%) Gaps:0/49 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 VKTHLRNMIIVPEMTGSIIGVYNGKDFGQVEVKPEMIGHYLGEFALTYK 127
            :||.:|:..|:|.|.|:...|:|||.:..|::..:||||.|||||.|.|
pombe    35 IKTAVRSATILPRMVGAQFMVHNGKSYANVKITEDMIGHKLGEFAPTRK 83

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS15NP_611136.1 PTZ00096 20..146 CDD:185442 23/49 (47%)
rsm19NP_592912.2 RpsS 9..91 CDD:223263 23/49 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0185
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100373
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.670

Return to query results.
Submit another query.