DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS15 and Rps15

DIOPT Version :9

Sequence 1:NP_611136.1 Gene:RpS15 / 36851 FlyBaseID:FBgn0034138 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_033117.1 Gene:Rps15 / 20054 MGIID:98117 Length:145 Species:Mus musculus


Alignment Length:139 Identity:109/139 - (78%)
Similarity:126/139 - (90%) Gaps:0/139 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KKKRTFKKFTYRGVDLDQLLDMPNNQLVELMHSRARRRFSRGLKRKPMALIKKLRKAKKEAPPNE 74
            ||||||:|||||||||||||||...||::|..:|.|||.:|||:||..:|:|:||||||||||.|
Mouse     7 KKKRTFRKFTYRGVDLDQLLDMSYEQLMQLYSARQRRRLNRGLRRKQHSLLKRLRKAKKEAPPME 71

  Fly    75 KPEIVKTHLRNMIIVPEMTGSIIGVYNGKDFGQVEVKPEMIGHYLGEFALTYKPVKHGRPGIGAT 139
            |||:||||||:|||:|||.||::||||||.|.|||:||||||||||||::|||||||||||||||
Mouse    72 KPEVVKTHLRDMIILPEMVGSMVGVYNGKTFNQVEIKPEMIGHYLGEFSITYKPVKHGRPGIGAT 136

  Fly   140 HSSRFIPLK 148
            |||||||||
Mouse   137 HSSRFIPLK 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS15NP_611136.1 PTZ00096 20..146 CDD:185442 96/125 (77%)
Rps15NP_033117.1 PTZ00096 1..143 CDD:185442 105/135 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167850338
Domainoid 1 1.000 146 1.000 Domainoid score I4538
eggNOG 1 0.900 - - E1_COG0185
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 232 1.000 Inparanoid score I3419
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62186
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002162
OrthoInspector 1 1.000 - - oto92805
orthoMCL 1 0.900 - - OOG6_100373
Panther 1 1.100 - - LDO PTHR11880
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2774
SonicParanoid 1 1.000 - - X1624
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.790

Return to query results.
Submit another query.