DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4945 and KKQ8

DIOPT Version :9

Sequence 1:NP_788382.1 Gene:CG4945 / 36850 FlyBaseID:FBgn0034137 Length:577 Species:Drosophila melanogaster
Sequence 2:NP_012753.2 Gene:KKQ8 / 853686 SGDID:S000001651 Length:724 Species:Saccharomyces cerevisiae


Alignment Length:354 Identity:88/354 - (24%)
Similarity:135/354 - (38%) Gaps:84/354 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IHK-----IREFELEKIQLVDE----FD-----IIQIVGEGWFGKILLVEHRGSQTE-------- 51
            |||     ::|..|:..:.:.|    |.     .:.:||.|.:|::.|.....::.:        
Yeast   381 IHKSLQNYLQEKNLKPAECIGEQAPTFQDNYGHPVGLVGAGAYGEVKLCARLRNEKDSPPFETYH 445

  Fly    52 -------MVLKAVPKPYVTLRDF----YREFHYGLHLGVHRH---------IVTTYDVAFETAGF 96
                   .|.:..|||...|..|    ..||..| |...|.|         |:..:|: .|.:..
Yeast   446 DSKYIYYAVKELKPKPDSDLEKFCTKITSEFIIG-HSLSHYHKNGKKPAPNILNVFDI-LEDSSS 508

  Fly    97 YVFTQEYAPLGDLTSNVTDSGVGEVYSKR---------VAKQLASAIDYMHSKDIVHRDIKLDNV 152
            ::...|:.|.|||...:    ||:...|.         ..|||...:.:||...|.|.|:|.:|:
Yeast   509 FIEVMEFCPAGDLYGML----VGKSKLKGRLHPLEADCFMKQLLHGVKFMHDHGIAHCDLKPENI 569

  Fly   153 LIYRSDFQRIKLCDFGESFPTGSTVERR---------NEWLPYSPPEVLEIKPEGSYKADPSHDV 208
            |.|....  :|:||||.|....:..|||         :|  ||..||..   .:|.|......|.
Yeast   570 LFYPHGL--LKICDFGTSSVFQTAWERRVHAQKGIIGSE--PYVAPEEF---VDGEYYDPRLIDC 627

  Fly   209 WQFGIVIFVCLTGCLPWQKAASD-DPRYVRYLAWQGGLMMMPLRRTPRLFKLLTS-NAQRMFKRF 271
            |..|:|....:.|...|:.|:.: |..|..:      ...|..:...|:|:.|.. |::....|.
Yeast   628 WSCGVVYITMILGHYLWKVASREKDMSYDEF------YKEMQRKNQFRVFEELKHVNSELATNRK 686

  Fly   272 FA--RISN-RPKSLADVTKFLDDRWLAKT 297
            .|  ||.. .|:....|.|.||.:|:..|
Yeast   687 IALYRIFQWEPRKRISVGKLLDMQWMKST 715

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4945NP_788382.1 SPS1 25..358 CDD:223589 83/333 (25%)
STKc_SBK1 32..293 CDD:270889 79/311 (25%)
KKQ8NP_012753.2 PKc_like 418..712 CDD:419665 79/312 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.