DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4945 and LOC791840

DIOPT Version :9

Sequence 1:NP_788382.1 Gene:CG4945 / 36850 FlyBaseID:FBgn0034137 Length:577 Species:Drosophila melanogaster
Sequence 2:NP_001189435.1 Gene:LOC791840 / 791840 -ID:- Length:385 Species:Danio rerio


Alignment Length:442 Identity:132/442 - (29%)
Similarity:212/442 - (47%) Gaps:72/442 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKKPRGNIHKIREFE------LEKIQLVDEFDIIQIVGEGWFGKILLVEHRGSQTEMVLKAVPK 59
            ||..|..:...:.|.:      |||:::...:::|:.:|:|.:||:.||.|:...::|.||.:.|
Zfish     1 MSSSPVVSHDILEELQLYTAQNLEKLEVNKYYEVIRELGKGTYGKVDLVIHKIRGSKMALKFLKK 65

  Fly    60 PYVTLRDFYREFHYGLHLGVHRHIVTTYDVAFETAGFYVFTQEYAPLGDLTSNVTDS-GVGEVYS 123
            ....|:.|.||:...|:|.....|:..:.:||||..:|||.|||||.|||...:... |:.|..:
Zfish    66 KSTKLKSFLREYSISLYLSPCPFIINMFGIAFETDEYYVFAQEYAPSGDLFDIIPPQVGLPEPVA 130

  Fly   124 KRVAKQLASAIDYMHSKDIVHRDIKLDNVLIYRSDFQRIKLCDFGESFPTGSTVERRNEWLPYSP 188
            ||...|:|.|::|:|||.:||||||.:|:||:..:.:::||.|||.:...||.|:|.:..:||:.
Zfish   131 KRCVHQVAIALEYLHSKKLVHRDIKPENILIFDKECRKVKLSDFGMARRAGSPVKRVSGTIPYTA 195

  Fly   189 PEVLEIKPEGSYKADPSHDVWQFGIVIFVCLTGCLPWQKAASDDPRYVRYLAWQGGLMMMPLRRT 253
            ||:.:......:..|.|.|||.||:::|..|||..||:||...|..|..::.||       .|||
Zfish   196 PELCDTSKHDGFCVDYSTDVWAFGVLLFCMLTGNFPWEKAMPSDTFYEEFVRWQ-------KRRT 253

  Fly   254 ---PRLFKLLTSNAQRMFKRFFARISNRPKSLADVTKFLDDRWLAKTAQKEMAEYETDELCPSMY 315
               |..::..|..:.|||::..|....|..|:.:|...|..||:.........:           
Zfish   254 GAVPSQWRRFTDESLRMFRKLLALEQERRCSVKEVFAHLGHRWMLDGTSGNHHQ----------- 307

  Fly   316 SFHSSPDEKNKLLYTLADCGIETNVDRQQKKNRIKDWIESSIITEEDEEENEETNSASPSSSVSR 380
            |..:|..|:::||           |||.:::                        :.||:::.|.
Zfish   308 SVLNSSSEEDELL-----------VDRMKQQ------------------------TLSPTANTSN 337

  Fly   381 EPLPG---HISSLRKPTSPAESAKEINSTLKDATQKHFDPRTGALQQGPSEM 429
            ...||   |.:|:    |...|....||..:.|  :...|.:..|...|.|:
Zfish   338 AIEPGSANHFTSV----STNSSVSSTNSYERSA--RDSPPTSRILVTTPIEI 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4945NP_788382.1 SPS1 25..358 CDD:223589 109/336 (32%)
STKc_SBK1 32..293 CDD:270889 98/264 (37%)
LOC791840NP_001189435.1 STKc_SBK1 38..296 CDD:270889 98/264 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.