DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4945 and SBK2

DIOPT Version :9

Sequence 1:NP_788382.1 Gene:CG4945 / 36850 FlyBaseID:FBgn0034137 Length:577 Species:Drosophila melanogaster
Sequence 2:NP_001357025.1 Gene:SBK2 / 646643 HGNCID:34416 Length:348 Species:Homo sapiens


Alignment Length:284 Identity:97/284 - (34%)
Similarity:149/284 - (52%) Gaps:9/284 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 VDE-FDIIQIVGEGWFGKILLVEHRGSQTEMVLKAVPKPYVTLRDFYREFHYGLHLGVHRHIVTT 86
            ||| ::.::.:|:|.:|::|||.||...|.:.||.:|||..:||.|..||..||.||.|..|||.
Human    58 VDELYEEVRPLGQGCYGRVLLVTHRQKGTPLALKQLPKPRTSLRGFLYEFCVGLSLGAHSAIVTA 122

  Fly    87 YDVAFETAGFYVFTQEYAPLGDLTSNVTDS-GVGEVYSKRVAKQLASAIDYMHSKDIVHRDIKLD 150
            |.:..|:|..|.|..|....|||.:.:... |:.:....|.|.|||||::|:|::.:|:||:|.:
Human   123 YGIGIESAHSYSFLTEPVLHGDLMAFIQPKVGLPQPAVHRCAAQLASALEYIHARGLVYRDLKPE 187

  Fly   151 NVLIYRSDFQRIKLCDFGESFPTGSTVERRNEWLPYSPPEVLEIK--PEGSYKADPSHDVWQFGI 213
            |||:.....:|.||.|||.:.|.|:.:......:||:.||:....  ||| ....|:.|.|..|:
Human   188 NVLVCDPACRRFKLTDFGHTRPRGTLLRLAGPPIPYTAPELCAPPPLPEG-LPIQPALDAWALGV 251

  Fly   214 VIFVCLTGCLPWQK-AASDDPRYVRYLAWQGGLMMMPLRRTPRLFKLLTSNAQRMFKRFFARISN 277
            ::|..|||..||.: .|..||.|..:|.||..  ..| |..|:.:..|.:.|..:.:........
Human   252 LLFCLLTGYFPWDRPLAEADPFYEDFLIWQAS--GQP-RDRPQPWFGLAAAADALLRGLLDPHPR 313

  Fly   278 RPKSLADVTKFLDDRWLAKTAQKE 301
            |..::..:.:.|...|..:..:.|
Human   314 RRSAVIAIREHLGRPWRQREGEAE 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4945NP_788382.1 SPS1 25..358 CDD:223589 95/282 (34%)
STKc_SBK1 32..293 CDD:270889 92/264 (35%)
SBK2NP_001357025.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..25
PKc_like 68..329 CDD:354810 92/264 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 164 1.000 Domainoid score I3939
eggNOG 1 0.900 - - E1_KOG1345
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 168 1.000 Inparanoid score I4153
Isobase 1 0.950 - 0 Normalized mean entropy S3635
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1221624at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8584
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4887
SonicParanoid 1 1.000 - - X768
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
109.810

Return to query results.
Submit another query.