DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4945 and SBK1

DIOPT Version :9

Sequence 1:NP_788382.1 Gene:CG4945 / 36850 FlyBaseID:FBgn0034137 Length:577 Species:Drosophila melanogaster
Sequence 2:XP_005255372.1 Gene:SBK1 / 388228 HGNCID:17699 Length:458 Species:Homo sapiens


Alignment Length:265 Identity:99/265 - (37%)
Similarity:147/265 - (55%) Gaps:5/265 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 FDIIQIVGEGWFGKILLVEHRGSQTEMVLKAVPKPYVTLRDFYREFHYGLHLGVHRHIVTTYDVA 90
            :::::.:|:|.:||:.||.::|:.|:|.||.|.|....|::|.||......|.....|:..:||.
Human    87 YELVRELGKGTYGKVDLVVYKGTGTKMALKFVNKSKTKLKNFLREVSITNSLSSSPFIIKVFDVV 151

  Fly    91 FETAGFYVFTQEYAPLGDLTSNVTDS-GVGEVYSKRVAKQLASAIDYMHSKDIVHRDIKLDNVLI 154
            |||...|||.|||||.|||...:... |:.|...||..:||..|:|:||.:.:||||||.:|||:
Human   152 FETEDCYVFAQEYAPAGDLFDIIPPQVGLPEDTVKRCVQQLGLALDFMHGRQLVHRDIKPENVLL 216

  Fly   155 YRSDFQRIKLCDFGESFPTGSTVERRNEWLPYSPPEVLEIKPEGSYKADPSHDVWQFGIVIFVCL 219
            :..:.:|:||.|||.:...|..|:|.:..:||:.|||.:.........|...|||.||::||..|
Human   217 FDRECRRVKLADFGMTRRVGCRVKRVSGTIPYTAPEVCQAGRADGLAVDTGVDVWAFGVLIFCVL 281

  Fly   220 TGCLPWQKAASDDPRYVRYLAWQGGLMMMPLRRTPRLFKLLTSNAQRMFKRFFARISNRPKSLAD 284
            ||..||:.|:..|..:..::.||.|    .|...|..::..|..|.|||:|..|....|.....:
Human   282 TGNFPWEAASGADAFFEEFVRWQRG----RLPGLPSQWRRFTEPALRMFQRLLALEPERRGPAKE 342

  Fly   285 VTKFL 289
            |.:||
Human   343 VFRFL 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4945NP_788382.1 SPS1 25..358 CDD:223589 99/265 (37%)
STKc_SBK1 32..293 CDD:270889 99/259 (38%)
SBK1XP_005255372.1 S_TKc 87..350 CDD:214567 99/265 (37%)
STKc_SBK1 93..351 CDD:270889 99/259 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165155073
Domainoid 1 1.000 164 1.000 Domainoid score I3939
eggNOG 1 0.900 - - E1_KOG1345
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 168 1.000 Inparanoid score I4153
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1221624at2759
OrthoFinder 1 1.000 - - FOG0002130
OrthoInspector 1 1.000 - - mtm8584
orthoMCL 1 0.900 - - OOG6_106722
Panther 1 1.100 - - LDO PTHR24359
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4887
SonicParanoid 1 1.000 - - X768
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.790

Return to query results.
Submit another query.