DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4945 and hal4

DIOPT Version :9

Sequence 1:NP_788382.1 Gene:CG4945 / 36850 FlyBaseID:FBgn0034137 Length:577 Species:Drosophila melanogaster
Sequence 2:NP_594866.1 Gene:hal4 / 2542804 PomBaseID:SPAC29A4.16 Length:636 Species:Schizosaccharomyces pombe


Alignment Length:239 Identity:66/239 - (27%)
Similarity:105/239 - (43%) Gaps:46/239 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 QIVGEGWFGKILLVEHR------GSQTEMVLKAV-PKPYVTLRDFYR----EFHYGLHLGVHRHI 83
            :::|.|.|| ::.:.|:      ||:|...:|.. .||..:.:.:.:    ||.....|. |.::
pombe   355 EVIGRGAFG-VVRIAHKVDPQNSGSETLYAVKEFRRKPAESQKKYTKRLTSEFCISSSLR-HPNV 417

  Fly    84 VTTYDVAFETAGFYVFTQEYAPLGDLTSNVTDSG-VGEVYSKRVAKQLASAIDYMHSKDIVHRDI 147
            :.|.|:..:..|.|....|....|||.:.:..:| :..:.:....|||...:||:|...:.|||:
pombe   418 IHTLDLIQDGKGDYCEVMELCSGGDLYTLIMAAGRLEPMEADCFFKQLMRGVDYLHDMGVAHRDL 482

  Fly   148 KLDNVLIYRSDFQRIKLCDF--GESFPTGSTVERRNEW-------------LPYSPPEVLEIKPE 197
            |.:|:|:..|.  .:|:.||  ||.|        |..|             .||..||..   .|
pombe   483 KPENLLLTVSG--SLKITDFGNGECF--------RMAWEKEAHMTCGLCGSAPYIAPEEY---TE 534

  Fly   198 GSYKADP-SHDVWQFGIVIFVCLTGCLPWQKA-ASDDPRYVRYL 239
            ..:  || :.|||..|::.....||...|:.| .|:|..|.|||
pombe   535 SEF--DPRAVDVWACGVIYMAMRTGRHLWRVAKKSEDEYYSRYL 576

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4945NP_788382.1 SPS1 25..358 CDD:223589 66/239 (28%)
STKc_SBK1 32..293 CDD:270889 66/237 (28%)
hal4NP_594866.1 DamX 52..>211 CDD:225805
S_TKc 355..623 CDD:214567 66/239 (28%)
STKc_HAL4_like 357..623 CDD:270896 66/237 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.