DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4945 and Sbk1

DIOPT Version :9

Sequence 1:NP_788382.1 Gene:CG4945 / 36850 FlyBaseID:FBgn0034137 Length:577 Species:Drosophila melanogaster
Sequence 2:NP_671476.1 Gene:Sbk1 / 113907 RGDID:628713 Length:417 Species:Rattus norvegicus


Alignment Length:265 Identity:100/265 - (37%)
Similarity:149/265 - (56%) Gaps:5/265 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 FDIIQIVGEGWFGKILLVEHRGSQTEMVLKAVPKPYVTLRDFYREFHYGLHLGVHRHIVTTYDVA 90
            :::::.:|:|.:||:.||.::|:.|:|.||.|.|....|::|.||......|.....|:..:||.
  Rat    53 YELVRELGKGTYGKVDLVAYKGTGTKMALKFVNKSKTKLKNFLREVSITNSLSSSPFIIKVFDVV 117

  Fly    91 FETAGFYVFTQEYAPLGDLTSNVTDS-GVGEVYSKRVAKQLASAIDYMHSKDIVHRDIKLDNVLI 154
            |||...|||.|||||.|||...:... |:.|...||..:||..|:|:|||:.:||||||.:|||:
  Rat   118 FETEECYVFAQEYAPAGDLFDIIPPQVGLPEDTVKRCVQQLGLALDFMHSRQLVHRDIKPENVLL 182

  Fly   155 YRSDFQRIKLCDFGESFPTGSTVERRNEWLPYSPPEVLEIKPEGSYKADPSHDVWQFGIVIFVCL 219
            :..:.:|:||.|||.:...|..|:|.:..:||:.|||.:......:..|...|||.||::||..|
  Rat   183 FDRECRRVKLADFGMTRRVGCRVKRVSGTIPYTAPEVCQAGRADGFAVDTGVDVWAFGVLIFCVL 247

  Fly   220 TGCLPWQKAASDDPRYVRYLAWQGGLMMMPLRRTPRLFKLLTSNAQRMFKRFFARISNRPKSLAD 284
            ||..||:.|:..|..:..::.||.|    .|...|..::..|..|.|||:|..|....|.....:
  Rat   248 TGNFPWEAASGADAFFEEFVRWQRG----RLPGLPSQWRRFTEPALRMFQRLLALEPERRGPAKE 308

  Fly   285 VTKFL 289
            |.:||
  Rat   309 VFRFL 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4945NP_788382.1 SPS1 25..358 CDD:223589 100/265 (38%)
STKc_SBK1 32..293 CDD:270889 100/259 (39%)
Sbk1NP_671476.1 S_TKc 53..316 CDD:214567 100/265 (38%)
STKc_SBK1 59..317 CDD:270889 100/259 (39%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 321..405
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348947
Domainoid 1 1.000 165 1.000 Domainoid score I3818
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 169 1.000 Inparanoid score I4051
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1221624at2759
OrthoFinder 1 1.000 - - FOG0002130
OrthoInspector 1 1.000 - - mtm9059
orthoMCL 1 0.900 - - OOG6_106722
Panther 1 1.100 - - LDO PTHR24359
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X768
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.900

Return to query results.
Submit another query.