DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4945 and sbk3

DIOPT Version :9

Sequence 1:NP_788382.1 Gene:CG4945 / 36850 FlyBaseID:FBgn0034137 Length:577 Species:Drosophila melanogaster
Sequence 2:NP_001103885.1 Gene:sbk3 / 100003100 ZFINID:ZDB-GENE-080204-39 Length:344 Species:Danio rerio


Alignment Length:305 Identity:97/305 - (31%)
Similarity:149/305 - (48%) Gaps:35/305 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 DEFDIIQIVGEGWFGKILLVEHRGSQTEMVLKAVPKPYVTLRDFYREFHYGLHLGVHRHIVTTYD 88
            :.|.:|:.:|||.:||::|..|:...|.|.||..|:...||:.|.||::..:....|..:.....
Zfish    26 EHFKLIKKLGEGSYGKVMLAVHQRRGTPMALKFFPRRSTTLQAFLREYNLSVCFCTHPSLTRALG 90

  Fly    89 VAFETAGFYVFTQEYAPLGDLTS-NVTDSGVGEVYSKRVAKQLASAIDYMHSKDIVHRDIKLDNV 152
            :.:.|...|||.||....|||.: .|:::||.|..::||..||:||:.::||...||||||.:|:
Zfish    91 IFYSTPSHYVFAQEAGLYGDLYNVIVSEAGVSEHCTQRVMSQLSSAVSHLHSLGFVHRDIKPENI 155

  Fly   153 LIYRSDFQRIKLCDFGESFPTGSTVERRNEWL--PYSPPEVLEIKPEGSYKAD------PSHDVW 209
            .:.......:||.|||.:.|.|:.|  |..|.  |:..|||...|.....:.|      ||.|.|
Zfish   156 FLCDRSCHWVKLGDFGLARPQGTEV--RAVWYNSPFCVPEVEPAKTLSETEDDIWMTVEPSLDTW 218

  Fly   210 QFGIVIFVCLTGCLPWQKAASDDPRYVRYLAWQGGLMMMPLRRTPR----------LFKLLTSNA 264
            ..||:|:..||.|.||:::.||||.|.:|:.|        ..|..:          .|..|:|..
Zfish   219 ALGILIYCLLTSCFPWEESTSDDPSYCKYIDW--------FNRVGQRDAGEVGVADQFDSLSSLV 275

  Fly   265 QRMFKRFF---ARISNRPKSLADVTKFLDDRWLAKTAQKEMAEYE 306
            ..:.::..   .|:..||.   ::..:|...||.||.::|....|
Zfish   276 LELLRKLLNPEPRLRPRPD---EILSYLGGAWLLKTEKEEKRREE 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4945NP_788382.1 SPS1 25..358 CDD:223589 97/304 (32%)
STKc_SBK1 32..293 CDD:270889 89/282 (32%)
sbk3NP_001103885.1 S_TKc 28..>241 CDD:214567 77/214 (36%)
PKc_like 34..304 CDD:304357 89/282 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1345
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1221624at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm6333
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
54.780

Return to query results.
Submit another query.