DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DAT and CG1698

DIOPT Version :9

Sequence 1:NP_001261026.1 Gene:DAT / 36849 FlyBaseID:FBgn0034136 Length:644 Species:Drosophila melanogaster
Sequence 2:NP_001260835.1 Gene:CG1698 / 36006 FlyBaseID:FBgn0033443 Length:654 Species:Drosophila melanogaster


Alignment Length:582 Identity:208/582 - (35%)
Similarity:322/582 - (55%) Gaps:54/582 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 SKSKTPTPHDNDNNSI-----SDERETWSGKVDFLLSVIGFAVDLANVWRFPYLCYKNGGGAFLV 67
            |.|..|..|.:..:.:     ..:|::|:..::||:|.|..:|.|.||||||:...:||||||::
  Fly    50 SGSAPPPGHGDSPSGVEAGQPGKKRDSWNNDIEFLMSCIALSVGLGNVWRFPFTALENGGGAFVI 114

  Fly    68 PYGIMLVVGGIPLFYMELALGQHNRKGAITCWGRLVPLFKGIGYAVVLIAFYVDFYYNVIIAWSL 132
            ||.|:|::.|.|::|:|:.|||.:.:|::..:. ..|:.:||||..||....|..||..::|.:|
  Fly   115 PYLIVLILVGKPVYYLEMLLGQFSSRGSVKVYD-FSPIMRGIGYGQVLATGIVTTYYATLMALTL 178

  Fly   133 RFFFASFTNSLPWTSCNNIWNTPNCRPFESQNASRVPVIGNYSDLYAMGNQSLLYNETYMNGSSL 197
            |:|..||..:|||:.|...|.| .|.....|.|||.                     |.:.||.:
  Fly   179 RYFVDSFYPTLPWSYCREEWGT-ECLDSGPQEASRA---------------------TSLAGSGV 221

  Fly   198 DTSAVGHVEGFQSAASEYFNRYILELNRSEGIHD-LGAIKWDMALCLLIVYLICYFSLWKGISTS 261
            .|          ::|..||...||....|  |.| :|...|.:||.|.:.:::....::||:.:|
  Fly   222 RT----------TSAEFYFTNIILREKAS--IDDGIGYPSWSLALALAVAWIVIAGIMFKGVKSS 274

  Fly   262 GKVVWFTALFPYAVLLILLIRGLTLPGSFLGIQYYLTPNFSAIYKAEVWVDAATQVFFSLGPGFG 326
            ||..:|.|||||.|:|:||:|.|||||:|.|:.|:|.|.:..:.:.:||..|.|||||||...||
  Fly   275 GKASYFLALFPYVVMLVLLVRALTLPGAFDGVLYFLRPQWHKLLEPQVWYAAVTQVFFSLAICFG 339

  Fly   327 VLLAYASYNKYHNNVYKDALLTSFINSATSFIAGFVIFSVLGYMAHTLGVR-IEDVATEGPGLVF 390
            .::.|||||::.:|:|:||.:.:.:::.||.::|.:||.:||.:|:..... |..|...||||.|
  Fly   340 NIIMYASYNRFGHNIYRDANIVTTLDTFTSLLSGVIIFGILGNLAYENNTTDIASVVNGGPGLAF 404

  Fly   391 VVYPAAIAT---MPASTFWALIFFMMLLTLGLDSSFGGSEAIITALSDEFPKIKRNRELFVAGLF 452
            :.||.|||.   :|  ..::::||:||..||:.|:.|.:..:.|.:.|:|..:|  ....|.|:.
  Fly   405 ISYPDAIAKFKWLP--QLFSVLFFLMLFVLGIGSNVGMASCMSTVIKDQFGHLK--NWTVVVGIA 465

  Fly   453 SLYFVVGLASCTQGGFYFFHLLDRYAAGYSILVAVFFEAIAVSWIYGTNRFSEDIRDMIGFPPGR 517
            .:.:.:||...|.||.:..:|:|.:...:..||...||.:.::||||..|...|:..|||.....
  Fly   466 IVGYFLGLLYITPGGQFLLNLVDYFGVTFVALVLAIFELVTIAWIYGVKRLCRDVEFMIGIKTSL 530

  Fly   518 YWQVCWRFVAPIFLLFITVYGLIGYEPLTYADYVYPSWANALGWCIAGSSVVM-----IPAV 574
            |:::||..|.|:.:|.|.:|.|:.||||.|.||.|.|.....|||::...|..     ||||
  Fly   531 YYRICWAVVTPLLMLTILIYTLVLYEPLKYKDYTYQSGVYVFGWCLSAFGVGQVLFWAIPAV 592

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DATNP_001261026.1 SLC6sbd_SERT-like_u1 27..597 CDD:271405 204/558 (37%)
CG1698NP_001260835.1 SLC6sbd 75..552 CDD:271359 185/515 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440749
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0733
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D250396at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11616
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.