DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DAT and CG31904

DIOPT Version :9

Sequence 1:NP_001261026.1 Gene:DAT / 36849 FlyBaseID:FBgn0034136 Length:644 Species:Drosophila melanogaster
Sequence 2:NP_723310.1 Gene:CG31904 / 319016 FlyBaseID:FBgn0260479 Length:403 Species:Drosophila melanogaster


Alignment Length:199 Identity:60/199 - (30%)
Similarity:93/199 - (46%) Gaps:25/199 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 PTPHDNDNNSISDERETWSGKVDFLLSVIGFAVD---LANVWRFPYLCYKNGGG-AFLVPYGIML 73
            |..||..       |..|:...||..:....|..   .:.:..|..|   :||. .|::.|.:.:
  Fly    77 PYRHDKC-------RGRWAKSADFYFASCTHAFSSLIFSELSTFGIL---HGGWLLFIIAYLMGM 131

  Fly    74 VVGGIPLFYMELALGQHNRKGAITCWGRLVPLFKGIGYAVVLIAFYVDFYYNVIIAWSLRFFFAS 138
            :...:|:|.::..|||.:..|.|:.: |:.|:|||||||::|:......||::.....|.:...|
  Fly   132 LFYSLPIFLIQAFLGQFSSSGTISAF-RVAPIFKGIGYAILLLNLGTLTYYSIAAVVPLIYTVNS 195

  Fly   139 FTNSLPWTSCNNIWNTPNCRPFESQNAS-RVPVIGNYSDLYAMGNQS----LLYNETYMNGSSLD 198
            ....:||.||||.|||..|...|:.:.. .|.||  ::...|||.||    ||   :.:.|..|.
  Fly   196 IHPVIPWMSCNNSWNTQECSLHENYDVDFAVAVI--FTLALAMGVQSSVIPLL---SQVAGHGLS 255

  Fly   199 TSAV 202
            .:||
  Fly   256 YTAV 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DATNP_001261026.1 SLC6sbd_SERT-like_u1 27..597 CDD:271405 57/185 (31%)
CG31904NP_723310.1 SLC5-6-like_sbd 123..>243 CDD:294310 42/122 (34%)
Cuticle_4 276..344 CDD:292577
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440816
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0733
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11616
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.