DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DAT and slc6a4

DIOPT Version :9

Sequence 1:NP_001261026.1 Gene:DAT / 36849 FlyBaseID:FBgn0034136 Length:644 Species:Drosophila melanogaster
Sequence 2:XP_017946918.1 Gene:slc6a4 / 100493853 XenbaseID:XB-GENE-22062972 Length:664 Species:Xenopus tropicalis


Alignment Length:587 Identity:308/587 - (52%)
Similarity:402/587 - (68%) Gaps:41/587 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 ERETWSGKVDFLLSVIGFAVDLANVWRFPYLCYKNGGGAFLVPYGIMLVVGGIPLFYMELALGQH 90
            ||||||.|:||||||||:||||.|||||||:||:|||||||:||.||.|.|||||||||||:||:
 Frog   112 ERETWSKKIDFLLSVIGYAVDLGNVWRFPYVCYQNGGGAFLIPYVIMAVFGGIPLFYMELAMGQY 176

  Fly    91 NRKGAITCWGRLVPLFKGIGYAVVLIAFYVDFYYNVIIAWSLRFFFASFTNSLPWTSCNNIWNTP 155
            :|.|.|:.|.::.|||||||||:.:||.||.||||.|:||:|.:...||.:.||||||.|.|||.
 Frog   177 HRNGCISIWRKICPLFKGIGYAICMIALYVAFYYNTIMAWALYYLIFSFRSELPWTSCLNEWNTG 241

  Fly   156 NCRPFESQNASRVPVIGNYSDLYAMGNQSLLYNETYMNGSSLDTSAVGHVEGFQSAASEYFNRYI 220
            ||.              ||                      ...|:||......|.|.|::.|.:
 Frog   242 NCT--------------NY----------------------FQNSSVGWSNSSISPAEEFYTRLV 270

  Fly   221 LELNRSEGIHDLGAIKWDMALCLLIVYLICYFSLWKGISTSGKVVWFTALFPYAVLLILLIRGLT 285
            |::::|:|:||||.|.|.:.||||:::.:.|||:|||:.|||||||.||.|||.||.:|||||.|
 Frog   271 LQIHKSKGLHDLGGISWQLTLCLLLIFTVVYFSIWKGVKTSGKVVWVTATFPYIVLALLLIRGAT 335

  Fly   286 LPGSFLGIQYYLTPNFSAIYKAEVWVDAATQVFFSLGPGFGVLLAYASYNKYHNNVYKDALLTSF 350
            |||::.|:.:||.|::..:....||||||.|:|||||||||||||:|||||:|||.|:|||:||.
 Frog   336 LPGAWRGVLFYLQPDWEKLLTTAVWVDAAAQIFFSLGPGFGVLLAFASYNKFHNNCYQDALITST 400

  Fly   351 INSATSFIAGFVIFSVLGYMAHTLGVRIEDVATE-GPGLVFVVYPAAIATMPASTFWALIFFMML 414
            :|..|||::|.|||:||||||....:.:.:||.: ||.|:|:.|..|||.||||||:|:|||:||
 Frog   401 VNCMTSFMSGLVIFTVLGYMAEMRNLDVSEVAKDTGPSLLFITYAEAIANMPASTFFAIIFFLML 465

  Fly   415 LTLGLDSSFGGSEAIITALSDEFPKI-KRNRELFVAGLFSLYFVVGLASCTQGGFYFFHLLDRYA 478
            :||||||:|.|.|.:|||:.||||.| .:.|||||..|.|:.|:..|::.|.||.|...|.:.||
 Frog   466 ITLGLDSTFAGLEGVITAVLDEFPHIWGKRRELFVFLLISVCFLGALSTLTFGGAYMVKLFEEYA 530

  Fly   479 AGYSILVAVFFEAIAVSWIYGTNRFSEDIRDMIGFPPGRYWQVCWRFVAPIFLLFITVYGLIGYE 543
            .|.::|..||.|||||||.||.|:|..|:|:|:||.||.:|::||..:.|:|||||....:....
 Frog   531 TGPAVLTVVFLEAIAVSWFYGINQFCRDVREMLGFSPGWFWKICWVAICPLFLLFIICSFMSSPP 595

  Fly   544 PLTYADYVYPSWANALGWCIAGSSVVMIPAVAIFKLLSTPGSLRQRFTILTTPWRDQQSMAMVLN 608
            .|...:|.||||...||:||..||.:.:||..::.|.|||||:::||....||   :.|..:.|.
 Frog   596 DLRLFNYQYPSWTVVLGYCIGTSSFICVPAYMVYLLTSTPGSIKERFLKSITP---EVSREIPLG 657

  Fly   609 GV 610
            |:
 Frog   658 GI 659

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DATNP_001261026.1 SLC6sbd_SERT-like_u1 27..597 CDD:271405 303/571 (53%)
slc6a4XP_017946918.1 5HT_transport_N 48..91 CDD:367522
SLC5-6-like_sbd 113..649 CDD:382020 304/574 (53%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D250396at2759
OrthoFinder 1 1.000 - - FOG0000975
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X639
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.