DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment loopin-1 and CG32061

DIOPT Version :10

Sequence 1:NP_611134.1 Gene:loopin-1 / 36847 FlyBaseID:FBgn0259795 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_729611.1 Gene:CG32061 / 39196 FlyBaseID:FBgn0052061 Length:214 Species:Drosophila melanogaster


Alignment Length:40 Identity:10/40 - (25%)
Similarity:17/40 - (42%) Gaps:3/40 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   419 SVWQNFRKSGGLTG---DRVWRFPLFKYYKQIVNKNITYD 455
            |.|:..:..|.|.|   .|.....|..|:.||:...::.:
  Fly   157 SNWRAIQLYGELQGLFWHRSTSVTLIPYWSQIIGGGVSLE 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
loopin-1NP_611134.1 Peptidase_M17_N 44..173 CDD:426984
Peptidase_M17 206..514 CDD:459978 10/40 (25%)
CG32061NP_729611.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.