DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sema2a and SEMA4A

DIOPT Version :9

Sequence 1:NP_477507.1 Gene:Sema2a / 36846 FlyBaseID:FBgn0011260 Length:724 Species:Drosophila melanogaster
Sequence 2:NP_001180229.1 Gene:SEMA4A / 64218 HGNCID:10729 Length:761 Species:Homo sapiens


Alignment Length:692 Identity:196/692 - (28%)
Similarity:313/692 - (45%) Gaps:131/692 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LQLSPLLALLLLLCSS----------VSETAADYENTWNFYYERPCCTGNDQGNNNYGKHGADHV 58
            |.|..||.|||...::          |...|.|.....:|::::                     
Human    16 LFLFQLLQLLLPTTTAGGGGQGPMPRVRYYAGDERRALSFFHQK--------------------- 59

  Fly    59 REFNCGKLYYRTFHMNEDRDTLYVGAMDRVFRVNLQNISSSNCNRDVINLE-----PTRDDVVS- 117
                 |...:.|..::.|.:||||||.:.:..:::|       :..|..|:     |..|...| 
Human    60 -----GLQDFDTLLLSGDGNTLYVGAREAILALDIQ-------DPGVPRLKNMIPWPASDRKKSE 112

  Fly   118 CVSKGKSQIFDCKNHVRVIQSMDQGDRLYVCGTNAHNPK-DYVIYANLTHLPRSEYVIGVGLGIA 181
            |..|.||....|.|.:||:.|.:. ..||.|||.|.:|. .::...:...||.||..:..|.|  
Human   113 CAFKKKSNETQCFNFIRVLVSYNV-THLYTCGTFAFSPACTFIELQDSYLLPISEDKVMEGKG-- 174

  Fly   182 KCPYDPLDNSTAIYVENGNPGGLPGLYSGTNAEFTKADTVIFRTDLYNTSAKRLEYKFKRTLKYD 246
            :.|:||....||:.|:     |:  |||||...|..::.::.|| |.:....:.: .|.|.|.:|
Human   175 QSPFDPAHKHTAVLVD-----GM--LYSGTMNNFLGSEPILMRT-LGSQPVLKTD-NFLRWLHHD 230

  Fly   247 SKWLDKPNFVGSFDIGEYVYFFFRETAVEYINCGKAVYSRIARVCKKDVGGKNLLAHNWATYLKA 311
            :      :||.:....:.|||||.|||.|:....:...||:|||||.||||:.||...|.|:|||
Human   231 A------SFVAAIPSTQVVYFFFEETASEFDFFERLHTSRVARVCKNDVGGEKLLQKKWTTFLKA 289

  Fly   312 RLNCSISGEFPFYFNEIQSVYQLPSDK---SRFFATFTT--STNGLIGSAVCSFHINEIQAAFNG 371
            :|.|:..|:.|  ||.|:....||:|.   ...:|.||:  ...|...||||:|.:.:|:..|.|
Human   290 QLLCTQPGQLP--FNVIRHAVLLPADSPTAPHIYAVFTSQWQVGGTRSSAVCAFSLLDIERVFKG 352

  Fly   372 KFKEQSSSNSAWLPVLNSRVPE--PRPGTCVNDTSNLPDTVLNFIRSHPLMDKAVNHEHNNPVYY 434
            |:||.:...|.|   ...|.||  ||||:|....|:  |..|.|::.|.|||:.|   ...|:..
Human   353 KYKELNKETSRW---TTYRGPETNPRPGSCSVGPSS--DKALTFMKDHFLMDEQV---VGTPLLV 409

  Fly   435 KRDLVFTKLVVDKIR-IDILNQEYIVYYVGTNLGRIYKIVQYYRNGESLSKLLDIFEVAPN-EAI 497
            |..:.:|:|.|:..: :|  ...::|.|:||..|.::|.|.   :|:|.:.|::..::.|: |.:
Human   410 KSGVEYTRLAVETAQGLD--GHSHLVMYLGTTTGSLHKAVV---SGDSSAHLVEEIQLFPDPEPV 469

  Fly   498 QVMEISQTRKSLYIGTDHRIKQIDLAMCNRRYDNCFRCV--RDPYCGWDKEANTC----RPYELD 556
            :.::::.|:.::::|....:.::..|.|: .|::|..||  |||:|.||.|:.||    .|....
Human   470 RNLQLAPTQGAVFVGFSGGVWRVPRANCS-VYESCVDCVLARDPHCAWDPESRTCCLLSAPNLNS 533

  Fly   557 LLQDVANETSD-ICDSSVLK------------KKIVVTYGQSVHLGCFVKIPEVLKNEQVTWYHH 608
            ..||:.....: .|.|..:.            |:::......:.|.|    |.:.......|.| 
Human   534 WKQDMERGNPEWACASGPMSRSLRPQSRPQIIKEVLAVPNSILELPC----PHLSALASYYWSH- 593

  Fly   609 SKDKGRYEIRYSPTKYIE---TTERGLVVVSVNEADGGRYDC 647
                       .|....|   |...|.:::.|.:..||.|.|
Human   594 -----------GPAAVPEASSTVYNGSLLLIVQDGVGGLYQC 624

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sema2aNP_477507.1 Sema_2A 66..523 CDD:200499 149/472 (32%)
Ig_Semaphorin_C 573..664 CDD:143180 15/90 (17%)
SEMA4ANP_001180229.1 Sema_4A 55..495 CDD:200517 151/505 (30%)
PSI 496..541 CDD:214655 17/45 (38%)
Ig 566..638 CDD:353325 15/75 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 722..749
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3611
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11036
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
43.870

Return to query results.
Submit another query.