DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sema2a and SEMA3F

DIOPT Version :10

Sequence 1:NP_477507.1 Gene:Sema2a / 36846 FlyBaseID:FBgn0011260 Length:724 Species:Drosophila melanogaster
Sequence 2:NP_004177.3 Gene:SEMA3F / 6405 HGNCID:10728 Length:785 Species:Homo sapiens


Alignment Length:38 Identity:12/38 - (31%)
Similarity:15/38 - (39%) Gaps:5/38 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 PSTGSGSGG----ADVVPPAFRTSSLQSLSWLHAISPC 62
            ||.|.|.||    .|...|. .|....:.||.:..:.|
Human   199 PSGGGGGGGQQRAGDWKCPN-PTCENMNFSWRNECNQC 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sema2aNP_477507.1 Sema_2A 66..523 CDD:200499
PSI 527..>550 CDD:396154
Ig_Semaphorin_C 573..668 CDD:409368
Ig strand A 573..579 CDD:409368
Ig strand B 583..591 CDD:409368
Ig strand C 601..607 CDD:409368
Ig strand C' 609..612 CDD:409368
Ig strand D 622..626 CDD:409368
Ig strand E 630..637 CDD:409368
Ig strand F 643..652 CDD:409368
Ig strand G 655..668 CDD:409368
SEMA3FNP_004177.3 Sema_3F 48..548 CDD:200515 12/38 (32%)
PSI 547..584 CDD:214655
Ig_Sema3 608..697 CDD:409455
Ig strand A 608..614 CDD:409455
Ig strand B 619..627 CDD:409455
Ig strand C 633..639 CDD:409455
Ig strand C' 641..644 CDD:409455
Ig strand D 654..658 CDD:409455
Ig strand E 661..668 CDD:409455
Ig strand F 674..683 CDD:409455
Ig strand G 686..697 CDD:409455
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 752..785
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.