DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sema2a and Sema1b

DIOPT Version :9

Sequence 1:NP_477507.1 Gene:Sema2a / 36846 FlyBaseID:FBgn0011260 Length:724 Species:Drosophila melanogaster
Sequence 2:NP_001163178.1 Gene:Sema1b / 37007 FlyBaseID:FBgn0016059 Length:770 Species:Drosophila melanogaster


Alignment Length:514 Identity:185/514 - (35%)
Similarity:276/514 - (53%) Gaps:64/514 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 YYRTFHMNEDRDTLYVGAMDRVFRVNLQNISSSNCNRDVINLE--PTRDDVVSCVSKGKSQIFDC 129
            |::....|:  :.:.|||.|.::.|:|..:      :::..||  .|..|...|..|||.: :||
  Fly    60 YFKILDHND--EFVLVGAKDVIYNVSLNGL------KEIARLEWHSTDADRELCALKGKHE-WDC 115

  Fly   130 KNHVRVIQSMDQGDRLYVCGTNAHNPK-----------DYVIYANLTHLPRSEY---VIGVGLGI 180
            .|::||......|:.| :||||::.|:           :....|...|..|.|.   |...||  
  Fly   116 HNYLRVYALRPNGEVL-LCGTNSYKPRCRHYTPVEVSSEEAGSAGHAHAMRYEVSRDVEAQGL-- 177

  Fly   181 AKCPYDPLDNSTAIYVENGNPGGLPGLYSGTNAEFTKADTVIFRTDLYNTSAKRLEYKFKRTLKY 245
              |||.|..|||..:.:.       .|||.|.|:|:..|.:|:|.:|             ||.:|
  Fly   178 --CPYSPAHNSTYAFADG-------HLYSATVADFSGGDPLIYRENL-------------RTEQY 220

  Fly   246 DSKWLDKPNFVGSFDIGEYVYFFFRETAVEYINCGKAVYSRIARVCKKDVGGKNLLAHNWATYLK 310
            |.|.|::|:|||:.:...||.|||||.::|.:|.|||||||:|||||.|.||......:|.::||
  Fly   221 DLKQLNQPDFVGAIERNGYVLFFFRELSMEVMNFGKAVYSRVARVCKNDRGGPYSHGKSWTSFLK 285

  Fly   311 ARLNCSISGEFPFYFNEIQSVYQL--PSDKSRFFATFTTSTNGLIGSAVCSFHINEIQAAFNGKF 373
            ||||||:.|||||||:|||::..:  ...||..:|.||||.|.:.|||||:|::::|.|||:|:|
  Fly   286 ARLNCSVPGEFPFYFDEIQAISPIVESGSKSLIYAVFTTSVNAIPGSAVCAFNVDDILAAFDGEF 350

  Fly   374 KEQSSSNSAWLPVLNSRVPEPRPGTCVNDTSNLPDTVLNFIRSHPLMDKAVNHEHNNPVYYKRDL 438
            |.|..|.|.||||...:||:||||.||.|:..|....:|||::||||::||...|..|:..|.:|
  Fly   351 KSQKDSQSHWLPVEREQVPKPRPGQCVEDSRTLTSIAVNFIKNHPLMEEAVPAVHGRPLLTKVNL 415

  Fly   439 --VFTKLVVDKIRIDILNQEYIVYYVGTNLGRIYKIVQYYRN--GESLSKLLDI----FEVAP-N 494
              ..|.:.|......:....|.|.|.||:.|::.|.:.....  ..::.:|..:    .:|.| .
  Fly   416 HHRLTAIAVHPQVKSLSGAYYDVIYSGTDDGKVTKFINILSTHPNSTVDRLKTVVISEMQVLPLG 480

  Fly   495 EAIQVMEISQTRKSLYIGTDHRIKQIDLAMCNRRYDNCFRC--VRDPYCGWDKEANTCR 551
            ..|:.:.||.::.||.:.:|..:..:.|..|:...| |..|  ::||.|.||.:.:.|:
  Fly   481 TPIRELVISTSKNSLVVVSDGSLVSVPLHHCSHIVD-CLGCLSLQDPICAWDLQTHECK 538

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sema2aNP_477507.1 Sema_2A 66..523 CDD:200499 174/482 (36%)
Ig_Semaphorin_C 573..664 CDD:143180
Sema1bNP_001163178.1 Sema_1A 55..511 CDD:200498 175/484 (36%)
PSI 510..>537 CDD:214655 9/27 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3611
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11036
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.