DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sema2a and Sema3f

DIOPT Version :9

Sequence 1:NP_477507.1 Gene:Sema2a / 36846 FlyBaseID:FBgn0011260 Length:724 Species:Drosophila melanogaster
Sequence 2:XP_038937516.1 Gene:Sema3f / 315996 RGDID:1308514 Length:802 Species:Rattus norvegicus


Alignment Length:683 Identity:204/683 - (29%)
Similarity:315/683 - (46%) Gaps:136/683 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 GADHVREFNCGKLYYRTFHMNEDRDTLYVGAMDRVFRVNLQNISSSNCNRD--VINLEPTRDDVV 116
            |..|...|......||....:||.|.:|||:.|.|..::|.:|     ||:  :|:...:...:.
  Rat    60 GTAHFFNFLLNTTDYRILFKDEDHDRMYVGSKDYVLSLDLHDI-----NREPLIIHWAASPQRIE 119

  Fly   117 SCVSKGKSQIFDCKNHVRVIQSMDQGDRLYVCGTNAHNPKDYVIYAN---------LTHL----- 167
            .|:..||....:|.|.||:||..:: ..||||||.|:||  ...|.|         .|.:     
  Rat   120 ECILSGKDGNGECGNFVRLIQPWNR-THLYVCGTGAYNP--MCTYVNRGRRSQAPPWTQMQVVRG 181

  Fly   168 ----------------PRSEYVI-----GVGLGIAKCPYDP-LDNSTAIYVENGNPGGLPGLYSG 210
                            ||.:|:.     .:..|..|||||| ||.::|:..|.        ||:|
  Rat   182 RGSRATDGADRPTPTAPRQDYIFYLEPEKLESGKGKCPYDPKLDTASALINEE--------LYAG 238

  Fly   211 TNAEFTKADTVIFRTDLYNTSAKRLEYKFKRTLKYDSKWLDKPNFVGSFDI-------GEYVYFF 268
            ...:|...|..||||....|:        .||.:|:|:||:.|:|:.:..|       .:.:|||
  Rat   239 VYIDFMGTDAAIFRTLGKQTA--------MRTDQYNSRWLNDPSFIHAELIPDSAERNDDKLYFF 295

  Fly   269 FRETAVEYINCGKAVYSRIARVCKKDVGGKNLLAHNWATYLKARLNCSISGE--FPFYFNEIQSV 331
            |||.:.|... ..|||:||.|:|..|.||...|.:.|:|:|||||.||:.||  ...:|:|:|.|
  Rat   296 FRERSAEAPQ-NPAVYARIGRICLNDDGGHCCLVNKWSTFLKARLVCSVPGEDGIETHFDELQDV 359

  Fly   332 YQLPSDKSR---FFATFTTSTNGLIGSAVCSFHINEIQAAFNGKFKEQSSSNSAWLPVLNSRVPE 393
            :...:...|   .:|.||:|.:...|||||.:.:.:|:..|||.|..:...|..|:| .:.::|.
  Rat   360 FVQQTQDVRNPVIYAVFTSSGSVFRGSAVCVYSMADIRMVFNGPFAHKEGPNYQWMP-FSGKMPY 423

  Fly   394 PRPGTC--------VNDTSNLPDTVLNFIRSHPLMDKAVNHEHNNPVYYKRDLVF--TKLVVDKI 448
            ||||||        :..|.:.||.|:||:|:||||.:||......|:..:....:  |.:.||  
  Rat   424 PRPGTCPGGTFTPSMKSTKDYPDEVINFMRTHPLMYQAVYPLQRRPLVVRTGAPYRLTTVAVD-- 486

  Fly   449 RIDILNQEYIVYYVGTNLGRIYKIVQYYRNGESLSKLL----DIF-EVAPNEAIQVMEISQTRKS 508
            ::|..:..|.|.::||:.|.:.|::...::.:.:.:|:    ::| |.||   ::.|.||..|:.
  Rat   487 QVDAADGRYEVLFLGTDRGTVQKVIVLPKDDQEVEELMLEEVEVFKEPAP---VKTMTISSKRQQ 548

  Fly   509 LYIGTDHRIKQIDLAMCNRRYDNCFRC--VRDPYCGWDKEANTCRPY-----ELDLLQDV----- 561
            ||:.:...:..:.|..|......|..|  .|||||.||.:|  |..|     .....|||     
  Rat   549 LYVASAVGVTHLSLHRCQAYGAACADCCLARDPYCAWDGQA--CSRYTASSKRRSRRQDVRHGNP 611

  Fly   562 --------ANETSDICDSSVLKKKIVVTY---GQSVHLGCFVKIPEVLKNEQVTW-YHHSKDKGR 614
                    :|...:..:|        |.|   |.:..|.|..:.|:.    .|.| :.......|
  Rat   612 IRQCRGFNSNANKNAIES--------VQYGVAGSAAFLECQPRSPQA----TVKWLFQRDPSDRR 664

  Fly   615 YEIRYSPTKYIETTERGLVVVSVNEADGGRYDC 647
            .||| :..:::. ||:||::.::...|.|.|.|
  Rat   665 REIR-AEDRFLR-TEQGLLLRALQLGDRGLYSC 695

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sema2aNP_477507.1 Sema_2A 66..523 CDD:200499 162/521 (31%)
Ig_Semaphorin_C 573..664 CDD:143180 20/79 (25%)
Sema3fXP_038937516.1 Sema_3F 65..565 CDD:200515 164/530 (31%)
PSI 564..601 CDD:214655 13/38 (34%)
Ig_Sema3 625..714 CDD:409455 21/85 (25%)
Ig strand B 639..643 CDD:409455 1/3 (33%)
Ig strand C 651..655 CDD:409455 1/3 (33%)
Ig strand E 678..682 CDD:409455 2/3 (67%)
Ig strand F 692..697 CDD:409455 2/4 (50%)
Ig strand G 709..712 CDD:409455
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 50 1.000 Domainoid score I11361
eggNOG 1 0.900 - - E1_KOG3611
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11036
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X596
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.910

Return to query results.
Submit another query.