DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sema2a and Sema4b

DIOPT Version :9

Sequence 1:NP_477507.1 Gene:Sema2a / 36846 FlyBaseID:FBgn0011260 Length:724 Species:Drosophila melanogaster
Sequence 2:NP_001163933.1 Gene:Sema4b / 293042 RGDID:1307872 Length:821 Species:Rattus norvegicus


Alignment Length:569 Identity:176/569 - (30%)
Similarity:276/569 - (48%) Gaps:90/569 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 VREFNCGKL-YYRTFHMNEDRDTLYVGAMDRVFRV--NLQNISSSNCNRDVINLEPTRDDVVSCV 119
            :|:|....: .|....:::|..||||||.:.:|.:  ||..:........:.:.:|.|..  .|.
  Rat    44 IRKFEAENISNYTALLLSQDGKTLYVGAREALFALNSNLSFLPGGEYQELLWSADPDRKQ--QCS 106

  Fly   120 SKGKSQIFDCKNHVRVIQSMDQGDRLYVCGTNAHNPK-DYVIYANLTHLPRSEYVIGVGL---GI 180
            .|||....||:|:::::..:: ...|..|||.|.:|. .|:..|:.| |.|.|  .|..|   |.
  Rat   107 FKGKDPKRDCQNYIKILLPLN-SSHLLTCGTAAFSPLCAYINTASFT-LARDE--AGSVLLEDGK 167

  Fly   181 AKCPYDPLDNSTAIYVENGNPGGLPGLYSGTNAEFTKADTVIFRTDLYNTSAKRLEYKFKRTLKY 245
            .:||:||...|||:.|:.       .||:||.:.|...|..|.|:            :..|..|.
  Rat   168 GRCPFDPNFKSTALVVDG-------ELYTGTVSSFQGNDPAISRS------------QSPRPTKT 213

  Fly   246 DS--KWLDKPNFVGSFDIGE----------YVYFFFRETAVEYINCGKAVYSRIARVCKKDVGGK 298
            :|  .||..|.||.|..:.|          .:||||.||..|:......:.||:|||||.|.||:
  Rat   214 ESSLNWLQDPAFVASAYVPESLGSPIGDDDKIYFFFSETGQEFEFFENTIVSRVARVCKGDEGGE 278

  Fly   299 NLLAHNWATYLKARLNCSISGE-FPFYFNEIQSVYQL---PSD--KSRFFATFTTSTN-GLI-GS 355
            .:|...|.::|||:|.||...: ||  ||.:|.|:.|   |.|  |:.|:..||:..: |.. ||
  Rat   279 RVLQQRWTSFLKAQLLCSRPDDGFP--FNVLQDVFTLNPNPQDWRKTLFYGVFTSQWHRGTTEGS 341

  Fly   356 AVCSFHINEIQAAFNGKFKEQSSSNSAWLPVLNSRVPEPRPGTC---------VNDTSNLPDTVL 411
            |:|.|.:|::|.||:|.:|:.:.....|....:. ||.||||.|         :|.:..|||.||
  Rat   342 AICVFTMNDVQKAFDGLYKKVNRETQQWYTETHP-VPTPRPGACITNSARERKINSSLQLPDRVL 405

  Fly   412 NFIRSHPLMDKAVNHEHNNPVYYKRDLVFTKLVVDKIRIDILNQEYIVYYVGTNLGRIYKIVQYY 476
            ||::.|.|||..|   .:..:..:....:.::.|.  |:..|:..|.|.::||..||::|.|.. 
  Rat   406 NFLKDHFLMDGQV---RSRLLLLQPQARYQRVAVH--RVPGLHSTYDVLFLGTGDGRLHKAVTL- 464

  Fly   477 RNGESLSKLLDIFEVAP-NEAIQVMEISQTRKSLYIGTDHRIKQIDLAMCNRRYDNCFRCV--RD 538
               :|...:::..:|.| .:.:|.:.:......||..:...:.|:.:|.|: .|..|..|:  ||
  Rat   465 ---DSRVHIIEELQVFPQGQPVQNLLLDSHGGLLYASSHSGVVQVPVANCS-LYPTCGDCLLARD 525

  Fly   539 PYCGWDKEANTCR---PYELDL-----LQDV--ANETSDICDSSVLKKK 577
            |||.|:  .:||:   .|:.||     :||:  || |.::|:.|..|.:
  Rat   526 PYCAWN--GSTCKLLSLYQPDLASRPWIQDIEGAN-TKELCNISSAKAR 571

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sema2aNP_477507.1 Sema_2A 66..523 CDD:200499 150/493 (30%)
Ig_Semaphorin_C 573..664 CDD:143180 1/5 (20%)
Sema4bNP_001163933.1 Sema 46..509 CDD:417757 151/499 (30%)
PSI 510..556 CDD:396154 17/48 (35%)
Ig_Sema4B_like 577..661 CDD:409456
Ig strand B 590..594 CDD:409456
Ig strand C 602..606 CDD:409456
Ig strand E 624..627 CDD:409456
Ig strand F 637..642 CDD:409456
Ig strand G 654..657 CDD:409456
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm45857
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11036
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.