DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sema2a and SEMA3D

DIOPT Version :9

Sequence 1:NP_477507.1 Gene:Sema2a / 36846 FlyBaseID:FBgn0011260 Length:724 Species:Drosophila melanogaster
Sequence 2:NP_001371829.1 Gene:SEMA3D / 223117 HGNCID:10726 Length:777 Species:Homo sapiens


Alignment Length:648 Identity:202/648 - (31%)
Similarity:319/648 - (49%) Gaps:116/648 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 LYYRTFHMNEDRDTLYVGAMDRVFRVNLQNISSSNCNRDVINLEPTRDDVVSCVSKGKSQIFDCK 130
            |.::|..::|:|..|.:||.|.:|.::|.::   |.|...|.....::.|..|...||....:|.
Human    68 LDFQTLLLDEERGRLLLGAKDHIFLLSLVDL---NKNFKKIYWPAAKERVELCKLAGKDANTECA 129

  Fly   131 NHVRVIQSMDQGDRLYVCGTNAHNP----------KDYVIYANLTHLPRSEYVIGVGLGIAKCPY 185
            |.:||:|..:: ..:|||||.|.:|          |:.:|:...||...|        |..|||:
Human   130 NFIRVLQPYNK-THIYVCGTGAFHPICGYIDLGVYKEDIIFKLDTHNLES--------GRLKCPF 185

  Fly   186 DPLDNSTAIYVENGNPGGLPGLYSGTNAEFTKADTVIFRTDLYNTSAKRLEYKFKRTLKYDSKWL 250
            ||.....::..:.       .|||||.::|...||. |...|..|.    ::.:.||...:..||
Human   186 DPQQPFASVMTDE-------YLYSGTASDFLGKDTA-FTRSLGPTH----DHHYIRTDISEHYWL 238

  Fly   251 DKPNFVGSFDI-------GEYVYFFFRETAVEYINCGKAVYSRIARVCKKDVGGKNLLAHNWATY 308
            :...|:|:|.|       .:.:||||||::.|.....|.:.||:.||||.||||:..|.:.|.|:
Human   239 NGAKFIGTFFIPDTYNPDDDKIYFFFRESSQEGSTSDKTILSRVGRVCKNDVGGQRSLINKWTTF 303

  Fly   309 LKARLNCSISGE--FPFYFNEIQSVYQLPSDKSR---FFATFTTSTNGLIGSAVCSFHINEIQAA 368
            |||||.|||.|.  ...||:|:|.:|.||:...|   .:..|||:::...|||||.:.:.:|:|.
Human   304 LKARLICSIPGSDGADTYFDELQDIYLLPTRDERNPVVYGVFTTTSSIFKGSAVCVYSMADIRAV 368

  Fly   369 FNGKFKEQSSSNSAWLPVLNSRVPEPRPGTC--------VNDTSNLPDTVLNFIRSHPLMDKAVN 425
            |||.:..:.|::..|:. .:.|:|.||||||        :..|.:.||.|::||:.|.:|.|:|.
Human   369 FNGPYAHKESADHRWVQ-YDGRIPYPRPGTCPSKTYDPLIKSTRDFPDDVISFIKRHSVMYKSVY 432

  Fly   426 HEHNNPVYYKR---DLVFTKLVVDKIRIDILNQEYIVYYVGTNLGRIYKIVQYYRNGESLSKL-- 485
            .....|. :||   |...|::|||.:..:  :.:|.|.::||::|.:.|:|...:...::.::  
Human   433 PVAGGPT-FKRINVDYRLTQIVVDHVIAE--DGQYDVMFLGTDIGTVLKVVSISKEKWNMEEVVL 494

  Fly   486 --LDIFEVAPNEAIQVMEISQTRKSLYIGTDHRIKQIDLAMCNRRYDNCFRC--VRDPYCGWDKE 546
              |.||:  .:..|..||:|..::.||||:...:.|:.|..|:.....|..|  .|||||.||  
Human   495 EELQIFK--HSSIILNMELSLKQQQLYIGSRDGLVQLSLHRCDTYGKACADCCLARDPYCAWD-- 555

  Fly   547 ANTCRPYE---------------------LDLLQDVANETSDICDSSVLKKKIVVTYG---QSVH 587
            .|.|..|.                     .|:...:::||:|        :|::  :|   .|..
Human   556 GNACSRYAPTSKRRARRQDVKYGDPITQCWDIEDSISHETAD--------EKVI--FGIEFNSTF 610

  Fly   588 LGCFVKIPEVLKNEQVT--WY-HHSKDKGRYEIRYSPTKYIETTERGLVVVSVNEADGGRYDC 647
            |.|   ||   |::|.|  || ..|.|:.|.|::  |.:.|..||.||::.|:.:.|.|.|.|
Human   611 LEC---IP---KSQQATIKWYIQRSGDEHREELK--PDERIIKTEYGLLIRSLQKKDSGMYYC 665

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sema2aNP_477507.1 Sema_2A 66..523 CDD:200499 157/493 (32%)
Ig_Semaphorin_C 573..664 CDD:143180 27/81 (33%)
SEMA3DNP_001371829.1 Sema_3D 61..534 CDD:200513 158/495 (32%)
PSI 533..570 CDD:214655 13/38 (34%)
Ig_Sema3 595..686 CDD:409455 29/89 (33%)
Ig strand B 609..613 CDD:409455 1/3 (33%)
Ig strand C 621..625 CDD:409455 1/3 (33%)
Ig strand E 648..652 CDD:409455 2/3 (67%)
Ig strand F 662..667 CDD:409455 2/4 (50%)
Ig strand G 679..682 CDD:409455
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 738..777
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I11345
eggNOG 1 0.900 - - E1_KOG3611
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D153798at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11036
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.