DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sema2a and SEMA4D

DIOPT Version :9

Sequence 1:NP_477507.1 Gene:Sema2a / 36846 FlyBaseID:FBgn0011260 Length:724 Species:Drosophila melanogaster
Sequence 2:NP_001358123.1 Gene:SEMA4D / 10507 HGNCID:10732 Length:862 Species:Homo sapiens


Alignment Length:654 Identity:205/654 - (31%)
Similarity:317/654 - (48%) Gaps:120/654 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 KHGADHVREFNCGKLY-YRTFHMNEDRDTLYVGAMDRVFRVNLQNISSSNCNRDVINLEPTRDDV 115
            :|...|:.:|:...:| |....::||:||||:||.:.||.||..|||.   .:..:..:.:.|..
Human    33 EHREVHLVQFHEPDIYNYSALLLSEDKDTLYIGAREAVFAVNALNISE---KQHEVYWKVSEDKK 94

  Fly   116 VSCVSKGKSQIFDCKNHVRVIQSMDQGDRLYVCGTNAHNPK-DYVIYANLTHLPRSEYVIGVGLG 179
            ..|..||||:..:|.|::||:|.: ....||||||||..|. |::...:...|.::|.      |
Human    95 AKCAEKGKSKQTECLNYIRVLQPL-SATSLYVCGTNAFQPACDHLNLTSFKFLGKNED------G 152

  Fly   180 IAKCPYDPLDNSTAIYVENGNPGGLPGLYSGTNAEFTKADTVIFRTDLYNTSAKRLEYKFKRTLK 244
            ..:||:||..:.|::.|:.       .|||||:..|..::.:|.|...:  |..|.||..     
Human   153 KGRCPFDPAHSYTSVMVDG-------ELYSGTSYNFLGSEPIISRNSSH--SPLRTEYAI----- 203

  Fly   245 YDSKWLDKPNFVGSFDI---------GE--YVYFFFRETAVEYINCGKAVYSRIARVCKKDVGGK 298
               .||::|:||.: |:         ||  .|||||.|.:|||....:.:..|||||||.|.||.
Human   204 ---PWLNEPSFVFA-DVIRKSPDSPDGEDDRVYFFFTEVSVEYEFVFRVLIPRIARVCKGDQGGL 264

  Fly   299 NLLAHNWATYLKARLNCS--ISGEFPFYFNEIQSVYQLPSDKSR---FFATFTTSTNGLIGSAVC 358
            ..|...|.::|||||.||  .||   ..||.::.|:.|.|...:   |:|.||...|.:..||||
Human   265 RTLQKKWTSFLKARLICSRPDSG---LVFNVLRDVFVLRSPGLKVPVFYALFTPQLNNVGLSAVC 326

  Fly   359 SFHINEIQAAF-NGKFKEQSS---SNSAWLPVLNSRVPEPRPGTCV-------NDTS--NLPDTV 410
            :::::..:..| :||:.:.::   |::.|:. .|..||:||||.|:       |.||  ||||..
Human   327 AYNLSTAEEVFSHGKYMQSTTVEQSHTKWVR-YNGPVPKPRPGACIDSEARAANYTSSLNLPDKT 390

  Fly   411 LNFIRSHPLMDKAVNHEHNNPVYYKRDLVFTKLVVDKIR-IDILNQEYIVYYVGTNLGRIYKIVQ 474
            |.|::.|||||.:|....|.|...|:|:.:|::|||:.: :|  ...|.|.:|.|:.|.::|.: 
Human   391 LQFVKDHPLMDDSVTPIDNRPRLIKKDVNYTQIVVDRTQALD--GTVYDVMFVSTDRGALHKAI- 452

  Fly   475 YYRNGESLSKLLDIFE----VAPNEAIQVMEISQTR--KSLYIGTDHRIKQIDLAMCNRRYDNCF 533
                  ||...:.|.|    ....|.:|.:.:|..:  :.:|.|::..:.|..||.|. ::..|.
Human   453 ------SLEHAVHIIEETQLFQDFEPVQTLLLSSKKGNRFVYAGSNSGVVQAPLAFCG-KHGTCE 510

  Fly   534 RCV--RDPYCGWDKEANTC------RPYELDLLQDVANETSDIC--DSSVLKKKIVVTYGQSVHL 588
            .||  |||||.|.....||      ......|:|:::.:.| :|  .|....::....:|.:..|
Human   511 DCVLARDPYCAWSPPTATCVALHQTESPSRGLIQEMSGDAS-VCPDKSKGSYRQHFFKHGGTAEL 574

  Fly   589 GC---------FVKIPE-VLKNEQVTWYHHSKDKGRYEIRYSPTKYIETTERGLVVVSVNEADGG 643
            .|         |.|... |||.|                  || ||.....:.|::.:::|.|.|
Human   575 KCSQKSNLARVFWKFQNGVLKAE------------------SP-KYGLMGRKNLLIFNLSEGDSG 620

  Fly   644 RYDC 647
            .|.|
Human   621 VYQC 624

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sema2aNP_477507.1 Sema_2A 66..523 CDD:200499 164/494 (33%)
Ig_Semaphorin_C 573..664 CDD:143180 19/85 (22%)
SEMA4DNP_001358123.1 Sema_4D 31..501 CDD:200520 167/508 (33%)
PSI 503..554 CDD:214655 15/52 (29%)
Ig_Sema4D_like 559..645 CDD:143281 19/85 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 794..837
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3611
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11036
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
43.870

Return to query results.
Submit another query.