DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sema2a and SEMA6C

DIOPT Version :9

Sequence 1:NP_477507.1 Gene:Sema2a / 36846 FlyBaseID:FBgn0011260 Length:724 Species:Drosophila melanogaster
Sequence 2:NP_001171532.1 Gene:SEMA6C / 10500 HGNCID:10740 Length:962 Species:Homo sapiens


Alignment Length:585 Identity:193/585 - (32%)
Similarity:295/585 - (50%) Gaps:103/585 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 PLLALLLLLCSSVSETAADYENTWNFYYERPCCTGNDQGNN--NYGKHGADHVREFNCGKLYYRT 70
            |||.|||||  |:..|.|.:...     ..|....:.||.:  ::.:...|.......|..:.|.
Human     9 PLLLLLLLL--SLPHTQAAFPQD-----PLPLLISDLQGTSPLSWFRGLEDDAVAAELGLDFQRF 66

  Fly    71 FHMNEDRDTLYVGAMDRVFRVNLQNISSSNCNRDVINLEPTR------DDVVSCVSKGKSQIFDC 129
            ..:|.   ||.|.|.|.||..:||      ...:...|.|.:      .||.:|..:|| ...:|
Human    67 LTLNR---TLLVAARDHVFSFDLQ------AEEEGEGLVPNKYLTWRSQDVENCAVRGK-LTDEC 121

  Fly   130 KNHVRVIQSMDQGDRLYVCGTNAHNP--KDYVIYANLTHLPRSEYVIGVGLGIAKCPYDPLDNST 192
            .|::||:...| ...|..||||:.:|  :.|    .:|.|.:....:.   |.|:||:|...::.
Human   122 YNYIRVLVPWD-SQTLLACGTNSFSPVCRSY----GITSLQQEGEELS---GQARCPFDATQSNV 178

  Fly   193 AIYVENGNPGGLPGLYSGTNAEFTKADTVIFRT-----DLYNTSAKRLEYKFKRTLKYDSKWLDK 252
            ||:.|.       .|||.|.|:|..:|.|::|:     .|             |:.|||||||.:
Human   179 AIFAEG-------SLYSATAADFQASDAVVYRSLGPQPPL-------------RSAKYDSKWLRE 223

  Fly   253 PNFVGSFDIGEYVYFFFRETAVEYINCGKAVYSRIARVCKKDVGGK-NLLAHNWATYLKARLNCS 316
            |:||.:.:.|::|||||||.:||....|:..:||:|||||:|:||. ..|..:|.::||.|||||
Human   224 PHFVQALEHGDHVYFFFREVSVEDARLGRVQFSRVARVCKRDMGGSPRALDRHWTSFLKLRLNCS 288

  Fly   317 ISGEFPFYFNEIQSVYQLPSD---KSRFFATFTTSTNGLIGSAVCSFHINEIQAAFNGKFKEQSS 378
            :.|:..|||:.:|::.. |.:   :|..|..|||.||.:.|||||:|:::||:..|.||||||.|
Human   289 VPGDSTFYFDVLQALTG-PVNLHGRSALFGVFTTQTNSIPGSAVCAFYLDEIERGFEGKFKEQRS 352

  Fly   379 SNSAWLPVLNSRVPEPRPGTCV--------NDTSNLPDTVLNFIRSHPLMDKAVNHEHNNPVYYK 435
            .:.||.||...|||.||||:|.        :.:.:|||.||.||::|||:|.||     .||.::
Human   353 LDGAWTPVSEDRVPSPRPGSCAGVGGAALFSSSRDLPDDVLTFIKAHPLLDPAV-----PPVTHQ 412

  Fly   436 RDLVFT-KLVVDKIRIDIL---NQEYIVYYVGTNLGRIYKIVQYYRNGES------LSKLLDIFE 490
            ..|..| :.::.::.:|.:   :....|.::|:|.|.:.|::.  ..|.|      |.:.:|.:.
Human   413 PLLTLTSRALLTQVAVDGMAGPHSNITVMFLGSNDGTVLKVLT--PGGRSGGPEPILLEEIDAYS 475

  Fly   491 VAPNEAIQVMEISQTRKSLYIGTD-HR--------IKQIDLAMCNRRYDNCFR-CV--RDPYCGW 543
            .|.....:..:.::....|.:.|: ||        |..:.|:.| .|:..|.| |:  :||||||
Human   476 PARCSGKRTAQTARRIIGLELDTEGHRLFVAFSGCIVYLPLSRC-ARHGACQRSCLASQDPYCGW 539

  Fly   544  543
            Human   540  539

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sema2aNP_477507.1 Sema_2A 66..523 CDD:200499 165/500 (33%)
Ig_Semaphorin_C 573..664 CDD:143180
SEMA6CNP_001171532.1 Sema 53..517 CDD:301699 166/509 (33%)
PSI 518..570 CDD:279745 11/23 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3611
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11036
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.