DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment knon and ATP7

DIOPT Version :9

Sequence 1:NP_611133.1 Gene:knon / 36845 FlyBaseID:FBgn0285943 Length:734 Species:Drosophila melanogaster
Sequence 2:NP_012909.3 Gene:ATP7 / 853853 SGDID:S000001499 Length:174 Species:Saccharomyces cerevisiae


Alignment Length:196 Identity:35/196 - (17%)
Similarity:85/196 - (43%) Gaps:48/196 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 WEKLVNCIKSNGGNGGVKNVSCQVVELADLMKQVPPNQMHKFKMFAKKHEEYKDRVRKYPESMPT 66
            |.|:::.::..|...                     .|:..||   |:::|.:.::.:. :|.||
Yeast    13 WAKVISSLRITGSTA---------------------TQLSSFK---KRNDEARRQLLEL-QSQPT 52

  Fly    67 -IDWEYYRQNVRE-EFVDWVKGYETKYDKLHSVFENRHAIVDHKRYFELVDE-EKKVVTKCISEY 128
             :|:.:||..::. ..:|.::.|..:|..:.         :|..:..::::. ||..:|.. .|.
Yeast    53 EVDFSHYRSVLKNTSVIDKIESYVKQYKPVK---------IDASKQLQVIESFEKHAMTNA-KET 107

  Fly   129 KAESDKRIQELTEKLEFVKAMRPYSEMTMEEFCFARPHL---APDFINKPTFWPHTPEEQMPGPS 190
            ::...|.:::|...|:.:::.||:.|:|:::....:|.:   ..:.:.|.. |      .:||..
Yeast   108 ESLVSKELKDLQSTLDNIQSARPFDELTVDDLTKIKPEIDAKVEEMVKKGK-W------DVPGYK 165

  Fly   191 D 191
            |
Yeast   166 D 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
knonNP_611133.1 Mt_ATP-synt_D 26..184 CDD:283519 29/163 (18%)
ATP7NP_012909.3 Mt_ATP-synt_D 5..145 CDD:399107 29/166 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346175
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3366
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2897
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003635
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12700
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.840

Return to query results.
Submit another query.