DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment knon and ATPQ

DIOPT Version :9

Sequence 1:NP_611133.1 Gene:knon / 36845 FlyBaseID:FBgn0285943 Length:734 Species:Drosophila melanogaster
Sequence 2:NP_190798.1 Gene:ATPQ / 824395 AraportID:AT3G52300 Length:168 Species:Arabidopsis thaliana


Alignment Length:146 Identity:34/146 - (23%)
Similarity:55/146 - (37%) Gaps:40/146 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 KFKMFAKKHEEYKDRVR-KYPESMPTIDWEYYRQNVREEFVDWVKGYETKYDKLHSVFENRHAIV 105
            :|....:..:|...::: |:.:....|||:|||:.:....||   .|:..||.:           
plant    36 EFSNLRRAFDEVNTQLQTKFSQEPEPIDWDYYRKGIGAGIVD---KYKEAYDSI----------- 86

  Fly   106 DHKRYFELVDEEKKVVTKCISEYKAESDKRIQEL----------TEKLE-----FVKAMRPYSEM 155
                      |..|.|.|...|||.:.|..:.||          :|:||     ..:..:..|.|
plant    87 ----------EIPKYVDKVTPEYKPKFDALLVELKEAEQKSLKESERLEKEIADVQEISKKLSTM 141

  Fly   156 TMEEFCFARPHLAPDF 171
            |.:|:....|.|...|
plant   142 TADEYFEKHPELKKKF 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
knonNP_611133.1 Mt_ATP-synt_D 26..184 CDD:283519 34/146 (23%)
ATPQNP_190798.1 Mt_ATP-synt_D 14..154 CDD:399107 32/141 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 49 1.000 Domainoid score I4440
eggNOG 1 0.900 - - E1_KOG3366
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1299717at2759
OrthoFinder 1 1.000 - - FOG0003635
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12700
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.010

Return to query results.
Submit another query.