DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment knon and Atp5h

DIOPT Version :9

Sequence 1:NP_611133.1 Gene:knon / 36845 FlyBaseID:FBgn0285943 Length:734 Species:Drosophila melanogaster
Sequence 2:NP_082138.1 Gene:Atp5h / 71679 MGIID:1918929 Length:161 Species:Mus musculus


Alignment Length:168 Identity:47/168 - (27%)
Similarity:81/168 - (48%) Gaps:10/168 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 KNVSCQVVELADLMKQVPPNQMHKFKMFAKKHEEYKDRVRKYPESMPTIDWEYYRQNVREEFVDW 83
            :.::.:.::....::.:|.||..........:|.:..|:....|..|.|||.|||.||.:..:  
Mouse     4 RKLALKTIDWVSFVEVMPQNQKAIGNALKSWNETFHARLASLSEKPPAIDWAYYRANVAKPGL-- 66

  Fly    84 VKGYETKYDKLHSVFENRHAIVDHKRYFELVDEEKKVVTKCISEYKAESDKRIQELTEKLEFVKA 148
            |..:|.||:.|       ...|...:|..|||:|:|...|..:|:.:.|..||||..::||.::.
Mouse    67 VDDFEKKYNAL-------KIPVPEDKYTALVDQEEKEDVKSCAEFVSGSQLRIQEYEKQLEKMRN 124

  Fly   149 MRPYSEMTMEEFCFARPHLAPDFINKPTFWPHTPEEQM 186
            :.|:.:||:::.....|....|....| :|||.|.|.:
Mouse   125 IIPFDQMTIDDLNEIFPETKLDKKKYP-YWPHQPIENL 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
knonNP_611133.1 Mt_ATP-synt_D 26..184 CDD:283519 46/157 (29%)
Atp5hNP_082138.1 Mt_ATP-synt_D 3..155 CDD:368646 43/160 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167849354
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3366
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2897
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003635
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12700
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.750

Return to query results.
Submit another query.