DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment knon and Atp5pd

DIOPT Version :9

Sequence 1:NP_611133.1 Gene:knon / 36845 FlyBaseID:FBgn0285943 Length:734 Species:Drosophila melanogaster
Sequence 2:NP_062256.1 Gene:Atp5pd / 641434 RGDID:620083 Length:161 Species:Rattus norvegicus


Alignment Length:168 Identity:45/168 - (26%)
Similarity:79/168 - (47%) Gaps:10/168 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 KNVSCQVVELADLMKQVPPNQMHKFKMFAKKHEEYKDRVRKYPESMPTIDWEYYRQNVREEFVDW 83
            :.::.:.::....::.:|.||..........:|.:..|:....|..|.|||.|||.||.:..:  
  Rat     4 RKLALKTIDWVSFVEIMPQNQKAIGNALKSWNETFHTRLASLSEKPPAIDWAYYRANVDKPGL-- 66

  Fly    84 VKGYETKYDKLHSVFENRHAIVDHKRYFELVDEEKKVVTKCISEYKAESDKRIQELTEKLEFVKA 148
            |..::.||:.|       ...|...:|..|||.|:|...|..:::...|..|::|..::||.:|.
  Rat    67 VDDFKNKYNAL-------KIPVPEDKYTALVDAEEKEDVKNCAQFVTGSQARVREYEKQLEKIKN 124

  Fly   149 MRPYSEMTMEEFCFARPHLAPDFINKPTFWPHTPEEQM 186
            |.|:.:||:::.....|....|....| :|||.|.|.:
  Rat   125 MIPFDQMTIDDLNEVFPETKLDKRKYP-YWPHQPIENL 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
knonNP_611133.1 Mt_ATP-synt_D 26..184 CDD:283519 44/157 (28%)
Atp5pdNP_062256.1 Mt_ATP-synt_D 3..155 CDD:399107 41/160 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352969
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3366
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1299717at2759
OrthoFinder 1 1.000 - - FOG0003635
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12700
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.810

Return to query results.
Submit another query.