DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment knon and LOC500350

DIOPT Version :9

Sequence 1:NP_611133.1 Gene:knon / 36845 FlyBaseID:FBgn0285943 Length:734 Species:Drosophila melanogaster
Sequence 2:NP_001041422.1 Gene:LOC500350 / 500350 RGDID:1560316 Length:409 Species:Rattus norvegicus


Alignment Length:98 Identity:27/98 - (27%)
Similarity:43/98 - (43%) Gaps:26/98 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 VDHKRYFELVDEEKKVVTKCISEYKAESDKRIQELTEKLEFVKAMRPYSEMTMEEFCFARPHLAP 169
            |...::..||||||. |..| :|:.:.|..|||:..::||.:|.:.|..:|..:|.         
  Rat   251 VPEDKHTALVDEEKD-VNNC-AEFLSGSQARIQKNEKQLEKMKNIIPSDQMITDEI--------- 304

  Fly   170 DFINKPTFWPHTPEEQMPGPSDPEAAAALHHEE 202
                       .||.::    |.:..|.|.|:|
  Rat   305 -----------FPETKL----DKKKMAPLAHQE 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
knonNP_611133.1 Mt_ATP-synt_D 26..184 CDD:283519 21/78 (27%)
LOC500350NP_001041422.1 Mt_ATP-synt_D <228..314 CDD:283519 23/88 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352971
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3366
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1299717at2759
OrthoFinder 1 1.000 - - FOG0003635
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12700
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.900

Return to query results.
Submit another query.