DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment knon and atp5pd

DIOPT Version :9

Sequence 1:NP_611133.1 Gene:knon / 36845 FlyBaseID:FBgn0285943 Length:734 Species:Drosophila melanogaster
Sequence 2:NP_001011021.1 Gene:atp5pd / 496430 XenbaseID:XB-GENE-993879 Length:161 Species:Xenopus tropicalis


Alignment Length:169 Identity:41/169 - (24%)
Similarity:76/169 - (44%) Gaps:12/169 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 KNVSCQVVELADLMKQVPPNQMHKFKMFAKKHEEYKDRVRKYPESMPTIDWEYYRQNVREEFVDW 83
            :..:.:.::.....::|||||...|.....:.:....::...||..|.|||.:||..|::  ...
 Frog     4 RRAALKAIDWMAFAERVPPNQKAMFNALKTRSDTVAGKLASLPEKTPVIDWAFYRTAVQK--AGM 66

  Fly    84 VKGYETKYDKLHSVFENRHAIVDHK-RYFELVDEEKKVVTKCISEYKAESDKRIQELTEKLEFVK 147
            |..:|.|:        |...|.:.| ...|.::.:::...|..:.|..||..|:.:..::||..:
 Frog    67 VDEFEKKF--------NATTIPEPKDTQTEKINAQEQESVKQAATYIQESKTRVSQYEKELERYR 123

  Fly   148 AMRPYSEMTMEEFCFARPHLAPDFINKPTFWPHTPEEQM 186
            .|.|:.:||.::...|.|....| ..|..:|||.|..::
 Frog   124 NMIPFDQMTFDDLHEAFPETRLD-KEKHVYWPHKPISEL 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
knonNP_611133.1 Mt_ATP-synt_D 26..184 CDD:283519 41/158 (26%)
atp5pdNP_001011021.1 Mt_ATP-synt_D 3..155 CDD:368646 38/161 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1299717at2759
OrthoFinder 1 1.000 - - FOG0003635
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12700
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.