DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment knon and ATPsynD

DIOPT Version :9

Sequence 1:NP_611133.1 Gene:knon / 36845 FlyBaseID:FBgn0285943 Length:734 Species:Drosophila melanogaster
Sequence 2:NP_001287401.1 Gene:ATPsynD / 42291 FlyBaseID:FBgn0016120 Length:178 Species:Drosophila melanogaster


Alignment Length:184 Identity:62/184 - (33%)
Similarity:91/184 - (49%) Gaps:11/184 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 KNVSCQVVELADLMKQVPPNQMHKFKMFAKKHEEYKDRVRKYPESMPTIDWEYYRQNVREEFVDW 83
            :.::...:..:.|.::||.||...|..|..|.:.|...|...||..|.|||..|::.|  .....
  Fly     4 RRIAQSSINWSALAERVPANQKSSFGAFKTKSDIYVRAVLANPECPPQIDWANYKKLV--PVAGL 66

  Fly    84 VKGYETKYDKLHSVFENRHAIVDHKRYFELVDEEKKVVTKCISEYKAESDKRIQELTEKLEFVKA 148
            |..::.:|:.|...:       ...:....||.|.|.....|..||..|::|||...:::..:|:
  Fly    67 VDSFQKQYEALKVPY-------PQDKVSSQVDAEIKASQSEIDAYKKASEQRIQNYQKEIAHLKS 124

  Fly   149 MRPYSEMTMEEFCFARPHLAPDFINKPTFWPHTPEEQMPGPSDP--EAAAALHH 200
            :.||.:||||::..|.|..|.|.:|||||||||||||:...|..  ||.|..||
  Fly   125 LLPYDQMTMEDYRDAFPDSALDPLNKPTFWPHTPEEQVGYKSKEQLEAEAQGHH 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
knonNP_611133.1 Mt_ATP-synt_D 26..184 CDD:283519 53/157 (34%)
ATPsynDNP_001287401.1 Mt_ATP-synt_D 11..160 CDD:283519 53/157 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469003
Domainoid 1 1.000 49 1.000 Domainoid score I4440
eggNOG 1 0.900 - - E1_KOG3366
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2897
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1299717at2759
OrthoFinder 1 1.000 - - FOG0003635
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12700
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.800

Return to query results.
Submit another query.