DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment knon and atp-5

DIOPT Version :9

Sequence 1:NP_611133.1 Gene:knon / 36845 FlyBaseID:FBgn0285943 Length:734 Species:Drosophila melanogaster
Sequence 2:NP_505829.1 Gene:atp-5 / 179541 WormBaseID:WBGene00007385 Length:191 Species:Caenorhabditis elegans


Alignment Length:143 Identity:27/143 - (18%)
Similarity:44/143 - (30%) Gaps:52/143 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 NGGVKNVSCQVVELADLMKQVPPNQMHKFKMFAKKHEEYKDRVRKYPESMPTIDW---------- 69
            :|..|.|:...|..:.|.:::.|....:..........::..|.:.|..:|.||:          
 Worm     2 SGAAKRVATSSVNWSKLAERLVPEHAAELTRVKGVSGTFQSAVSQLPADLPKIDFAALKKALPAH 66

  Fly    70 -----------------------EYYRQNVREEFVD-WVKGYETKYDKLHSVFENRHAIVDHKRY 110
                                   ||.::      || || .|.....|||.|           :.
 Worm    67 SAVLDSLQKQYESVKIPYGEVPAEYLKE------VDQWV-DYNNARIKLHEV-----------KV 113

  Fly   111 FELVDEEKKVVTK 123
            .:.:.|.|||..|
 Worm   114 ADGLQEAKKVEEK 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
knonNP_611133.1 Mt_ATP-synt_D 26..184 CDD:283519 24/132 (18%)
atp-5NP_505829.1 Mt_ATP-synt_D 13..155 CDD:283519 24/132 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166507
Domainoid 1 1.000 67 1.000 Domainoid score I6423
eggNOG 1 0.900 - - E1_KOG3366
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1299717at2759
OrthoFinder 1 1.000 - - FOG0003635
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12700
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.