DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment knon and ATP5PD

DIOPT Version :9

Sequence 1:NP_611133.1 Gene:knon / 36845 FlyBaseID:FBgn0285943 Length:734 Species:Drosophila melanogaster
Sequence 2:NP_006347.1 Gene:ATP5PD / 10476 HGNCID:845 Length:161 Species:Homo sapiens


Alignment Length:168 Identity:46/168 - (27%)
Similarity:78/168 - (46%) Gaps:10/168 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 KNVSCQVVELADLMKQVPPNQMHKFKMFAKKHEEYKDRVRKYPESMPTIDWEYYRQNVREEFVDW 83
            :.::.:.::.....:.:|.||..........:|....|:...||:.|.|||.||:.||.:  ...
Human     4 RKLALKTIDWVAFAEIIPQNQKAIASSLKSWNETLTSRLAALPENPPAIDWAYYKANVAK--AGL 66

  Fly    84 VKGYETKYDKLHSVFENRHAIVDHKRYFELVDEEKKVVTKCISEYKAESDKRIQELTEKLEFVKA 148
            |..:|.|::.|       ...|...:|...||.|:|...|..:|:.:.|..||.|..:::|.:|.
Human    67 VDDFEKKFNAL-------KVPVPEDKYTAQVDAEEKEDVKSCAEWVSLSKARIVEYEKEMEKMKN 124

  Fly   149 MRPYSEMTMEEFCFARPHLAPDFINKPTFWPHTPEEQM 186
            :.|:.:||:|:...|.|....|....| :|||.|.|.:
Human   125 LIPFDQMTIEDLNEAFPETKLDKKKYP-YWPHQPIENL 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
knonNP_611133.1 Mt_ATP-synt_D 26..184 CDD:283519 45/157 (29%)
ATP5PDNP_006347.1 Mt_ATP-synt_D 3..155 CDD:368646 42/160 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158973
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3366
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2897
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1299717at2759
OrthoFinder 1 1.000 - - FOG0003635
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12700
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
87.760

Return to query results.
Submit another query.