DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment S-Lap8 and grsm

DIOPT Version :9

Sequence 1:NP_611132.1 Gene:S-Lap8 / 36844 FlyBaseID:FBgn0034132 Length:534 Species:Drosophila melanogaster
Sequence 2:NP_731749.3 Gene:grsm / 41587 FlyBaseID:FBgn0040493 Length:655 Species:Drosophila melanogaster


Alignment Length:300 Identity:83/300 - (27%)
Similarity:134/300 - (44%) Gaps:34/300 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   215 LARRLSDTPANQMTPSIFAQATVDA---LCPCGVSVEVRSMDWIETQNLNSFLMVAKGSCEPPII 276
            :..|:.|.|.|:|....|.|...|.   ||   ::.:|...:.:..|.......|.|.:..||.:
  Fly   321 MTARIVDMPCNEMNVDHFIQEVEDVGRELC---ITPKVIRGEELLEQGFGGIYGVGKAAAVPPAL 382

  Fly   277 LEVSYCGTSPEERPILMLGKGLTFNSGGLCLHPKRGMDEYRGAVSGAAVCVAAIRAAAALSLPIN 341
            :.:|:.....:| .|.::|||:.:::|||.:..|.||...:....|||..:....||.......|
  Fly   383 VVLSHEPKGAQE-TIALVGKGIVYDTGGLSIKAKTGMPGMKRDCGGAAAILGTFYAAVQCGFRDN 446

  Fly   342 VSAVLPLCENMPSGMATKPGDVVTLLNGKTMRIKDISLAGTVLLADPLLYAQSTFKPKLVVEVGS 406
            :.||..|.||.....||:|.|:.||.:|:|:.|.:....|.::|||.:.||....|..:::::.:
  Fly   447 LHAVFCLAENSVGPNATRPDDIHTLYSGRTVEINNTDAEGRLVLADGVCYANKDLKANIILDMAT 511

  Fly   407 M--ASGIRKGL--GASATGLWTNNSFLW--KNFQKAGALTGDRLWRMPL-------WRYFRKLVA 458
            :  |.|:..|.  ||..|     ||..|  |:.| ||..:||.|  .|:       :..|...:|
  Fly   512 LTGAQGVATGKYHGAILT-----NSETWEAKSLQ-AGRKSGDLL--APIIYCPELHFSEFASAIA 568

  Fly   459 PRASYDICSTGEGHASSCLAAAILYEL---VPCSDWVHLD 495
            ...  :..:..:...|||....|...|   .| ..|:|:|
  Fly   569 DMK--NSVADRQNAQSSCAGLFIAAHLGFDYP-GIWMHVD 605

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
S-Lap8NP_611132.1 Peptidase_M17 51..528 CDD:238247 82/299 (27%)
PepB 66..532 CDD:223338 82/299 (27%)
grsmNP_731749.3 Peptidase_M17 141..628 CDD:238247 82/299 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472723
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0260
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D562530at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11963
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1683
SonicParanoid 00.000 Not matched by this tool.
65.880

Return to query results.
Submit another query.